Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SK11

Protein Details
Accession A0A397SK11    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-66NDSVIKKNKKKLKKTKQISIKAIDHydrophilic
NLS Segment(s)
PositionSequence
48-58KKNKKKLKKTK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MELGYKSYLIYYISSKPISNINEITSTLNTTLDAILMDTTSSNDSVIKKNKKKLKKTKQISIKAIDNTKKFFNIFTLMDMLIDLTEQLTAIDESRVLNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.28
5 0.29
6 0.3
7 0.27
8 0.24
9 0.25
10 0.26
11 0.27
12 0.21
13 0.2
14 0.16
15 0.14
16 0.12
17 0.11
18 0.1
19 0.07
20 0.07
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.05
27 0.05
28 0.06
29 0.05
30 0.07
31 0.09
32 0.15
33 0.24
34 0.33
35 0.38
36 0.45
37 0.54
38 0.61
39 0.7
40 0.76
41 0.79
42 0.8
43 0.82
44 0.84
45 0.86
46 0.86
47 0.8
48 0.74
49 0.68
50 0.62
51 0.61
52 0.57
53 0.49
54 0.43
55 0.39
56 0.36
57 0.31
58 0.27
59 0.23
60 0.22
61 0.2
62 0.19
63 0.19
64 0.17
65 0.16
66 0.16
67 0.13
68 0.08
69 0.07
70 0.06
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08