Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T4P2

Protein Details
Accession A0A397T4P2    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-120GKAGHNSRKKKVKKESSNPSPPLKBasic
NLS Segment(s)
PositionSequence
99-125AGHNSRKKKVKKESSNPSPPLKKKSKS
Subcellular Location(s) nucl 20, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences IDKLNSKIASLEAQLVQPIQAQPQNNDALEKMYIRAVRLGMLVDAPKDLTSLDNYINDELIRRSGVANTNYTKLSKKYSQMVNVVKKLIQHKCSKCGKAGHNSRKKKVKKESSNPSPPLKKKSKSHLTAKSQENSASRILVNSRDDPTSNTPKTPDSDGEDEILNEPMEINFVQKKDPATDVVTTKCKIKHLVIPGAIVDPVVKYPKPMLILPNTLLDKYNYDLLASKRELRLECN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.17
5 0.16
6 0.17
7 0.2
8 0.22
9 0.23
10 0.28
11 0.31
12 0.29
13 0.29
14 0.25
15 0.23
16 0.22
17 0.21
18 0.17
19 0.17
20 0.18
21 0.18
22 0.2
23 0.18
24 0.17
25 0.17
26 0.16
27 0.12
28 0.13
29 0.13
30 0.11
31 0.11
32 0.1
33 0.09
34 0.09
35 0.09
36 0.08
37 0.09
38 0.11
39 0.13
40 0.14
41 0.16
42 0.16
43 0.17
44 0.15
45 0.14
46 0.13
47 0.12
48 0.1
49 0.1
50 0.1
51 0.13
52 0.19
53 0.2
54 0.23
55 0.24
56 0.26
57 0.27
58 0.28
59 0.27
60 0.23
61 0.27
62 0.28
63 0.3
64 0.35
65 0.39
66 0.43
67 0.48
68 0.54
69 0.55
70 0.52
71 0.49
72 0.43
73 0.41
74 0.43
75 0.42
76 0.39
77 0.42
78 0.43
79 0.5
80 0.57
81 0.56
82 0.53
83 0.54
84 0.54
85 0.55
86 0.62
87 0.64
88 0.67
89 0.72
90 0.74
91 0.77
92 0.78
93 0.77
94 0.77
95 0.77
96 0.77
97 0.8
98 0.83
99 0.83
100 0.86
101 0.81
102 0.77
103 0.74
104 0.67
105 0.66
106 0.63
107 0.59
108 0.56
109 0.62
110 0.65
111 0.64
112 0.7
113 0.71
114 0.71
115 0.72
116 0.72
117 0.64
118 0.55
119 0.51
120 0.43
121 0.36
122 0.29
123 0.21
124 0.16
125 0.15
126 0.15
127 0.15
128 0.17
129 0.17
130 0.18
131 0.18
132 0.19
133 0.21
134 0.27
135 0.32
136 0.31
137 0.29
138 0.29
139 0.3
140 0.32
141 0.31
142 0.27
143 0.23
144 0.26
145 0.25
146 0.25
147 0.23
148 0.21
149 0.19
150 0.17
151 0.12
152 0.08
153 0.08
154 0.06
155 0.08
156 0.07
157 0.09
158 0.11
159 0.11
160 0.13
161 0.15
162 0.17
163 0.18
164 0.2
165 0.2
166 0.2
167 0.23
168 0.25
169 0.28
170 0.31
171 0.29
172 0.32
173 0.32
174 0.32
175 0.33
176 0.34
177 0.36
178 0.39
179 0.46
180 0.43
181 0.41
182 0.39
183 0.36
184 0.31
185 0.24
186 0.16
187 0.09
188 0.1
189 0.13
190 0.12
191 0.13
192 0.16
193 0.19
194 0.22
195 0.24
196 0.28
197 0.3
198 0.34
199 0.34
200 0.39
201 0.37
202 0.34
203 0.34
204 0.29
205 0.26
206 0.24
207 0.26
208 0.2
209 0.19
210 0.23
211 0.24
212 0.3
213 0.31
214 0.34
215 0.33
216 0.39