Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S801

Protein Details
Accession A0A397S801    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKKKQYLNDLKKRLKSKERSPDEAHydrophilic
82-110QLSNWLRSIHKHKRNRIRKQQSGQLDKDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MKKKQYLNDLKKRLKSKERSPDEANDIAARSKMKHILKGQIPNEYALDYDKTFIEQADKIYKKLISELKKLMSEYYNPSVTQLSNWLRSIHKHKRNRIRKQQSGQLDKDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.81
4 0.81
5 0.81
6 0.8
7 0.77
8 0.73
9 0.69
10 0.61
11 0.51
12 0.42
13 0.34
14 0.28
15 0.25
16 0.19
17 0.15
18 0.16
19 0.23
20 0.23
21 0.3
22 0.32
23 0.39
24 0.44
25 0.51
26 0.5
27 0.48
28 0.46
29 0.4
30 0.37
31 0.29
32 0.23
33 0.16
34 0.15
35 0.09
36 0.1
37 0.08
38 0.09
39 0.09
40 0.08
41 0.09
42 0.08
43 0.1
44 0.18
45 0.19
46 0.19
47 0.21
48 0.21
49 0.19
50 0.24
51 0.29
52 0.26
53 0.3
54 0.33
55 0.34
56 0.35
57 0.35
58 0.32
59 0.27
60 0.24
61 0.25
62 0.26
63 0.25
64 0.23
65 0.24
66 0.23
67 0.22
68 0.2
69 0.22
70 0.21
71 0.24
72 0.25
73 0.26
74 0.27
75 0.33
76 0.42
77 0.45
78 0.52
79 0.57
80 0.66
81 0.75
82 0.85
83 0.9
84 0.91
85 0.91
86 0.92
87 0.91
88 0.9
89 0.89
90 0.88