Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TGH1

Protein Details
Accession A0A397TGH1   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-103LREAYRRYKKETKLTYNYQKRLFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10.5, cyto 7, mito 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR045127  TAF11-like  
IPR006809  TAFII28_dom  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
Pfam View protein in Pfam  
PF04719  TAFII28  
CDD cd08048  TAF11  
Amino Acid Sequences MLLDNFSEEQLKRYEVYRRSALSKPNVKRMVGQILGHPCSHNMSIVVAGFAKVFVGEIVEKALDVRQEWGETGSLSPEHLREAYRRYKKETKLTYNYQKRLFTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.36
4 0.39
5 0.4
6 0.43
7 0.47
8 0.51
9 0.52
10 0.56
11 0.55
12 0.59
13 0.6
14 0.56
15 0.54
16 0.52
17 0.49
18 0.43
19 0.38
20 0.33
21 0.35
22 0.36
23 0.33
24 0.28
25 0.21
26 0.21
27 0.21
28 0.16
29 0.1
30 0.09
31 0.09
32 0.09
33 0.09
34 0.06
35 0.06
36 0.05
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.03
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.06
52 0.08
53 0.08
54 0.09
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.09
61 0.08
62 0.09
63 0.09
64 0.09
65 0.1
66 0.11
67 0.13
68 0.14
69 0.21
70 0.31
71 0.4
72 0.43
73 0.5
74 0.59
75 0.65
76 0.72
77 0.76
78 0.75
79 0.75
80 0.81
81 0.84
82 0.85
83 0.85
84 0.81