Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TFF4

Protein Details
Accession A0A397TFF4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-43VQKINLCNNKRIRKKPPKLCPDCKETNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito_nucl 13.333, cyto_nucl 11.833
Family & Domain DBs
Amino Acid Sequences MSSKKNYEQKTHITPYVQKINLCNNKRIRKKPPKLCPDCKETNDYVKSLSLRVNKIEEIVGMSENNSNKQQQSAPSGLVVFPLAQQISGFEQVSRANWQYWPYRNYGPDPMEVDNPSEYAFYCSSEYDAMELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.61
4 0.56
5 0.48
6 0.46
7 0.52
8 0.57
9 0.56
10 0.56
11 0.56
12 0.64
13 0.72
14 0.77
15 0.78
16 0.79
17 0.86
18 0.88
19 0.89
20 0.9
21 0.91
22 0.92
23 0.86
24 0.82
25 0.79
26 0.72
27 0.67
28 0.59
29 0.57
30 0.49
31 0.44
32 0.37
33 0.32
34 0.29
35 0.25
36 0.27
37 0.23
38 0.23
39 0.24
40 0.25
41 0.23
42 0.23
43 0.21
44 0.16
45 0.12
46 0.11
47 0.09
48 0.07
49 0.07
50 0.09
51 0.1
52 0.11
53 0.12
54 0.12
55 0.12
56 0.13
57 0.14
58 0.14
59 0.18
60 0.18
61 0.17
62 0.17
63 0.17
64 0.15
65 0.13
66 0.11
67 0.07
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.07
74 0.09
75 0.11
76 0.11
77 0.09
78 0.11
79 0.11
80 0.13
81 0.16
82 0.15
83 0.14
84 0.16
85 0.2
86 0.25
87 0.31
88 0.32
89 0.33
90 0.37
91 0.38
92 0.41
93 0.45
94 0.4
95 0.37
96 0.38
97 0.36
98 0.34
99 0.32
100 0.31
101 0.24
102 0.22
103 0.19
104 0.16
105 0.14
106 0.14
107 0.14
108 0.14
109 0.15
110 0.15
111 0.16
112 0.17
113 0.16