Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T007

Protein Details
Accession A0A397T007    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
122-149DDVDKKRVSNKIRQKNREKKIQRESTVPHydrophilic
NLS Segment(s)
PositionSequence
131-141NKIRQKNREKK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQSTDLLRELNAKLLAEIAELRKENAKISELKKENAEIPDLKRKQAVEESKRCDVENAELKARIEELEKNKADSSAENVRSDVEFAELKAEFNNAKQSTFRPSSPVSCQKSLEDGKMDVFLDDVDKKRVSNKIRQKNREKKIQRESTVPSNLSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.17
5 0.13
6 0.17
7 0.17
8 0.19
9 0.22
10 0.23
11 0.25
12 0.24
13 0.26
14 0.28
15 0.31
16 0.4
17 0.38
18 0.4
19 0.39
20 0.39
21 0.4
22 0.34
23 0.35
24 0.29
25 0.31
26 0.39
27 0.39
28 0.38
29 0.36
30 0.35
31 0.35
32 0.39
33 0.44
34 0.43
35 0.5
36 0.55
37 0.58
38 0.58
39 0.54
40 0.46
41 0.38
42 0.35
43 0.35
44 0.31
45 0.28
46 0.28
47 0.28
48 0.27
49 0.26
50 0.19
51 0.13
52 0.16
53 0.18
54 0.25
55 0.25
56 0.26
57 0.26
58 0.26
59 0.25
60 0.19
61 0.21
62 0.2
63 0.22
64 0.21
65 0.21
66 0.21
67 0.21
68 0.21
69 0.15
70 0.09
71 0.07
72 0.07
73 0.09
74 0.08
75 0.09
76 0.08
77 0.1
78 0.08
79 0.09
80 0.17
81 0.15
82 0.16
83 0.17
84 0.18
85 0.24
86 0.27
87 0.27
88 0.23
89 0.25
90 0.29
91 0.36
92 0.44
93 0.42
94 0.42
95 0.43
96 0.39
97 0.44
98 0.43
99 0.37
100 0.31
101 0.26
102 0.24
103 0.24
104 0.23
105 0.16
106 0.13
107 0.11
108 0.11
109 0.14
110 0.15
111 0.17
112 0.18
113 0.18
114 0.24
115 0.32
116 0.35
117 0.42
118 0.5
119 0.57
120 0.68
121 0.78
122 0.84
123 0.87
124 0.89
125 0.9
126 0.89
127 0.88
128 0.89
129 0.89
130 0.82
131 0.78
132 0.76
133 0.74
134 0.73
135 0.63