Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SHQ6

Protein Details
Accession A0A397SHQ6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-93KDKGKKTKNVSKYDRLREQNBasic
NLS Segment(s)
PositionSequence
78-78K
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
Amino Acid Sequences MWTDEQLRVLIDSRKDYNEKYYDLVGNGKRNFWKQVSTKINLQFGTSYSGAHCMEKFESLKRDHKRMKDYIDGKDKGKKTKNVSKYDRLREQNIARRNQSPPPPYEESSGSISQPQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.36
4 0.4
5 0.39
6 0.38
7 0.35
8 0.35
9 0.32
10 0.3
11 0.35
12 0.32
13 0.35
14 0.34
15 0.36
16 0.36
17 0.37
18 0.41
19 0.35
20 0.39
21 0.34
22 0.43
23 0.46
24 0.46
25 0.5
26 0.49
27 0.52
28 0.44
29 0.41
30 0.31
31 0.25
32 0.26
33 0.2
34 0.16
35 0.12
36 0.15
37 0.14
38 0.15
39 0.14
40 0.11
41 0.11
42 0.14
43 0.15
44 0.14
45 0.18
46 0.22
47 0.3
48 0.33
49 0.41
50 0.45
51 0.5
52 0.54
53 0.54
54 0.55
55 0.56
56 0.56
57 0.55
58 0.58
59 0.54
60 0.5
61 0.53
62 0.51
63 0.51
64 0.54
65 0.53
66 0.53
67 0.61
68 0.68
69 0.7
70 0.74
71 0.75
72 0.77
73 0.79
74 0.8
75 0.75
76 0.7
77 0.68
78 0.7
79 0.68
80 0.67
81 0.65
82 0.6
83 0.59
84 0.59
85 0.58
86 0.59
87 0.56
88 0.51
89 0.52
90 0.54
91 0.52
92 0.52
93 0.46
94 0.41
95 0.4
96 0.39
97 0.32