Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TD43

Protein Details
Accession A0A397TD43    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-71EAQQSKSKGGKRGRKKKQDTVAPPVSKHydrophilic
NLS Segment(s)
PositionSequence
50-61KSKGGKRGRKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.833, mito_nucl 12.666
Family & Domain DBs
Amino Acid Sequences MSSRTAKKCVNENISLDNVNKKGHKKEEPVTLPSDDLNNLLNNEEAQQSKSKGGKRGRKKKQDTVAPPVSKIIIDLLNDDDGSTKDLNEDKQDENKSRNEITPSNSTSKMISAIPDSRANSSFGHITSRTLRPRLTPLSPKDNMMNIVNNSRNISNASQYNFNMTDEDNPQKVMLEELIWKVIKCELNSAEGIEWIHTANRNSSNPLQKEEIIAFVDESTAIHVLSQWLNATNIEELRVQNLFSYLCRFIQHAFAVNYSSRDTEKMKTLDKIMKNIAVPSRNGKNFTSNLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.45
4 0.42
5 0.37
6 0.36
7 0.39
8 0.4
9 0.45
10 0.51
11 0.58
12 0.59
13 0.64
14 0.7
15 0.7
16 0.68
17 0.63
18 0.56
19 0.48
20 0.41
21 0.36
22 0.26
23 0.2
24 0.18
25 0.16
26 0.15
27 0.14
28 0.14
29 0.12
30 0.13
31 0.15
32 0.14
33 0.14
34 0.18
35 0.19
36 0.25
37 0.3
38 0.34
39 0.4
40 0.49
41 0.57
42 0.64
43 0.73
44 0.78
45 0.84
46 0.88
47 0.89
48 0.88
49 0.89
50 0.85
51 0.84
52 0.83
53 0.73
54 0.65
55 0.56
56 0.47
57 0.36
58 0.29
59 0.22
60 0.14
61 0.12
62 0.13
63 0.13
64 0.13
65 0.13
66 0.13
67 0.11
68 0.09
69 0.11
70 0.1
71 0.09
72 0.1
73 0.13
74 0.14
75 0.17
76 0.21
77 0.21
78 0.28
79 0.33
80 0.34
81 0.36
82 0.38
83 0.38
84 0.37
85 0.37
86 0.35
87 0.32
88 0.33
89 0.36
90 0.36
91 0.36
92 0.34
93 0.32
94 0.27
95 0.25
96 0.23
97 0.16
98 0.14
99 0.13
100 0.15
101 0.17
102 0.2
103 0.2
104 0.2
105 0.21
106 0.22
107 0.19
108 0.18
109 0.17
110 0.14
111 0.16
112 0.14
113 0.15
114 0.18
115 0.24
116 0.26
117 0.27
118 0.27
119 0.25
120 0.31
121 0.33
122 0.34
123 0.35
124 0.36
125 0.42
126 0.42
127 0.41
128 0.37
129 0.34
130 0.31
131 0.25
132 0.23
133 0.16
134 0.19
135 0.2
136 0.19
137 0.19
138 0.17
139 0.16
140 0.16
141 0.15
142 0.14
143 0.15
144 0.16
145 0.18
146 0.18
147 0.21
148 0.19
149 0.18
150 0.16
151 0.14
152 0.15
153 0.16
154 0.19
155 0.16
156 0.15
157 0.15
158 0.14
159 0.14
160 0.12
161 0.09
162 0.07
163 0.08
164 0.08
165 0.11
166 0.11
167 0.11
168 0.11
169 0.15
170 0.17
171 0.16
172 0.2
173 0.18
174 0.2
175 0.2
176 0.21
177 0.16
178 0.14
179 0.14
180 0.1
181 0.09
182 0.07
183 0.08
184 0.1
185 0.11
186 0.14
187 0.19
188 0.2
189 0.25
190 0.31
191 0.38
192 0.37
193 0.4
194 0.39
195 0.34
196 0.36
197 0.31
198 0.27
199 0.19
200 0.18
201 0.14
202 0.11
203 0.1
204 0.08
205 0.07
206 0.07
207 0.06
208 0.06
209 0.05
210 0.06
211 0.08
212 0.09
213 0.09
214 0.09
215 0.1
216 0.11
217 0.11
218 0.12
219 0.12
220 0.12
221 0.13
222 0.14
223 0.13
224 0.15
225 0.15
226 0.14
227 0.12
228 0.14
229 0.13
230 0.12
231 0.16
232 0.16
233 0.17
234 0.18
235 0.19
236 0.19
237 0.23
238 0.24
239 0.26
240 0.25
241 0.24
242 0.26
243 0.26
244 0.27
245 0.23
246 0.23
247 0.18
248 0.2
249 0.23
250 0.24
251 0.31
252 0.34
253 0.37
254 0.39
255 0.44
256 0.5
257 0.51
258 0.54
259 0.51
260 0.5
261 0.47
262 0.49
263 0.49
264 0.44
265 0.43
266 0.44
267 0.49
268 0.49
269 0.51
270 0.48
271 0.48
272 0.49