Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T4A1

Protein Details
Accession A0A397T4A1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
94-121SSTPKLTIRRSPRHRSRRARQLINNLQLHydrophilic
NLS Segment(s)
PositionSequence
103-111RSPRHRSRR
Subcellular Location(s) nucl 17.5, mito_nucl 12, mito 5.5, cyto 2
Family & Domain DBs
Amino Acid Sequences MSPISLTELKKTLSSLPNNKAGVPSGIKYEDLTHLDEYTEKISIMDQSARPFEGIQQGRHIIAKNRNVTTTNPIKIYQYHHQTLSRSEKQNYPSSTPKLTIRRSPRHRSRRARQLINNLQLDLWLPWWPSLQDLLNIDQTKYLPFTSFTKGLIRFAHMGFTFTPNFNTVIRDQLINIDGIYIKEWHKINVNPFDRSEKLPGRQPHWYQRYIDTKTTGYNKNLTIPINVNCCHLPSHKLPKISSLYHYRPKNEWTSYWHAPTSQVIFGKSIEQHNDLFSPSLTYIEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.5
4 0.57
5 0.57
6 0.56
7 0.5
8 0.44
9 0.39
10 0.33
11 0.29
12 0.25
13 0.26
14 0.26
15 0.25
16 0.25
17 0.25
18 0.24
19 0.26
20 0.22
21 0.21
22 0.21
23 0.21
24 0.2
25 0.17
26 0.15
27 0.12
28 0.11
29 0.11
30 0.13
31 0.15
32 0.18
33 0.18
34 0.21
35 0.23
36 0.24
37 0.23
38 0.21
39 0.21
40 0.26
41 0.27
42 0.25
43 0.28
44 0.29
45 0.3
46 0.32
47 0.32
48 0.3
49 0.34
50 0.41
51 0.43
52 0.43
53 0.45
54 0.44
55 0.44
56 0.45
57 0.45
58 0.4
59 0.35
60 0.34
61 0.34
62 0.35
63 0.38
64 0.38
65 0.38
66 0.37
67 0.39
68 0.41
69 0.41
70 0.45
71 0.48
72 0.48
73 0.45
74 0.45
75 0.47
76 0.49
77 0.55
78 0.51
79 0.47
80 0.46
81 0.45
82 0.45
83 0.42
84 0.44
85 0.45
86 0.45
87 0.48
88 0.51
89 0.57
90 0.64
91 0.72
92 0.76
93 0.79
94 0.86
95 0.88
96 0.88
97 0.88
98 0.88
99 0.87
100 0.82
101 0.82
102 0.8
103 0.77
104 0.68
105 0.57
106 0.48
107 0.39
108 0.33
109 0.22
110 0.14
111 0.08
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.1
118 0.09
119 0.1
120 0.11
121 0.12
122 0.17
123 0.17
124 0.16
125 0.15
126 0.15
127 0.14
128 0.13
129 0.12
130 0.07
131 0.09
132 0.12
133 0.14
134 0.15
135 0.16
136 0.19
137 0.2
138 0.22
139 0.21
140 0.2
141 0.18
142 0.17
143 0.2
144 0.15
145 0.16
146 0.14
147 0.17
148 0.16
149 0.14
150 0.15
151 0.13
152 0.14
153 0.13
154 0.15
155 0.12
156 0.15
157 0.15
158 0.14
159 0.13
160 0.14
161 0.14
162 0.12
163 0.11
164 0.08
165 0.07
166 0.07
167 0.08
168 0.08
169 0.08
170 0.13
171 0.14
172 0.15
173 0.19
174 0.23
175 0.29
176 0.37
177 0.4
178 0.37
179 0.39
180 0.43
181 0.4
182 0.39
183 0.4
184 0.35
185 0.35
186 0.41
187 0.44
188 0.43
189 0.49
190 0.52
191 0.55
192 0.56
193 0.57
194 0.51
195 0.54
196 0.59
197 0.55
198 0.53
199 0.45
200 0.4
201 0.42
202 0.46
203 0.44
204 0.38
205 0.38
206 0.35
207 0.37
208 0.4
209 0.35
210 0.32
211 0.3
212 0.32
213 0.33
214 0.32
215 0.29
216 0.26
217 0.26
218 0.26
219 0.24
220 0.26
221 0.29
222 0.39
223 0.41
224 0.46
225 0.46
226 0.51
227 0.54
228 0.52
229 0.49
230 0.48
231 0.51
232 0.55
233 0.6
234 0.57
235 0.55
236 0.58
237 0.6
238 0.55
239 0.5
240 0.49
241 0.52
242 0.54
243 0.54
244 0.5
245 0.42
246 0.4
247 0.4
248 0.37
249 0.33
250 0.29
251 0.26
252 0.26
253 0.25
254 0.29
255 0.28
256 0.29
257 0.29
258 0.3
259 0.29
260 0.31
261 0.31
262 0.28
263 0.25
264 0.2
265 0.19
266 0.17