Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T4A1

Protein Details
Accession A0A397T4A1   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
94-121SSTPKLTIRRSPRHRSRRARQLINNLQLHydrophilic
NLS Segment(s)
PositionSequence
103-111RSPRHRSRR
Subcellular Location(s) nucl 17.5, mito_nucl 12, mito 5.5, cyto 2
Family & Domain DBs
Amino Acid Sequences MSPISLTELKKTLSSLPNNKAGVPSGIKYEDLTHLDEYTEKISIMDQSARPFEGIQQGRHIIAKNRNVTTTNPIKIYQYHHQTLSRSEKQNYPSSTPKLTIRRSPRHRSRRARQLINNLQLDLWLPWWPSLQDLLNIDQTKYLPFTSFTKGLIRFAHMGFTFTPNFNTVIRDQLINIDGIYIKEWHKINVNPFDRSEKLPGRQPHWYQRYIDTKTTGYNKNLTIPINVNCCHLPSHKLPKISSLYHYRPKNEWTSYWHAPTSQVIFGKSIEQHNDLFSPSLTYIEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.5
4 0.57
5 0.57
6 0.56
7 0.5
8 0.44
9 0.39
10 0.33
11 0.29
12 0.25
13 0.26
14 0.26
15 0.25
16 0.25
17 0.25
18 0.24
19 0.26
20 0.22
21 0.21
22 0.21
23 0.21
24 0.2
25 0.17
26 0.15
27 0.12
28 0.11
29 0.11
30 0.13
31 0.15
32 0.18
33 0.18
34 0.21
35 0.23
36 0.24
37 0.23
38 0.21
39 0.21
40 0.26
41 0.27
42 0.25
43 0.28
44 0.29
45 0.3
46 0.32
47 0.32
48 0.3
49 0.34
50 0.41
51 0.43
52 0.43
53 0.45
54 0.44
55 0.44
56 0.45
57 0.45
58 0.4
59 0.35
60 0.34
61 0.34
62 0.35
63 0.38
64 0.38
65 0.38
66 0.37
67 0.39
68 0.41
69 0.41
70 0.45
71 0.48
72 0.48
73 0.45
74 0.45
75 0.47
76 0.49
77 0.55
78 0.51
79 0.47
80 0.46
81 0.45
82 0.45
83 0.42
84 0.44
85 0.45
86 0.45
87 0.48
88 0.51
89 0.57
90 0.64
91 0.72
92 0.76
93 0.79
94 0.86
95 0.88
96 0.88
97 0.88
98 0.88
99 0.87
100 0.82
101 0.82
102 0.8
103 0.77
104 0.68
105 0.57
106 0.48
107 0.39
108 0.33
109 0.22
110 0.14
111 0.08
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.1
118 0.09
119 0.1
120 0.11
121 0.12
122 0.17
123 0.17
124 0.16
125 0.15
126 0.15
127 0.14
128 0.13
129 0.12
130 0.07
131 0.09
132 0.12
133 0.14
134 0.15
135 0.16
136 0.19
137 0.2
138 0.22
139 0.21
140 0.2
141 0.18
142 0.17
143 0.2
144 0.15
145 0.16
146 0.14
147 0.17
148 0.16
149 0.14
150 0.15
151 0.13
152 0.14
153 0.13
154 0.15
155 0.12
156 0.15
157 0.15
158 0.14
159 0.13
160 0.14
161 0.14
162 0.12
163 0.11
164 0.08
165 0.07
166 0.07
167 0.08
168 0.08
169 0.08
170 0.13
171 0.14
172 0.15
173 0.19
174 0.23
175 0.29
176 0.37
177 0.4
178 0.37
179 0.39
180 0.43
181 0.4
182 0.39
183 0.4
184 0.35
185 0.35
186 0.41
187 0.44
188 0.43
189 0.49
190 0.52
191 0.55
192 0.56
193 0.57
194 0.51
195 0.54
196 0.59
197 0.55
198 0.53
199 0.45
200 0.4
201 0.42
202 0.46
203 0.44
204 0.38
205 0.38
206 0.35
207 0.37
208 0.4
209 0.35
210 0.32
211 0.3
212 0.32
213 0.33
214 0.32
215 0.29
216 0.26
217 0.26
218 0.26
219 0.24
220 0.26
221 0.29
222 0.39
223 0.41
224 0.46
225 0.46
226 0.51
227 0.54
228 0.52
229 0.49
230 0.48
231 0.51
232 0.55
233 0.6
234 0.57
235 0.55
236 0.58
237 0.6
238 0.55
239 0.5
240 0.49
241 0.52
242 0.54
243 0.54
244 0.5
245 0.42
246 0.4
247 0.4
248 0.37
249 0.33
250 0.29
251 0.26
252 0.26
253 0.25
254 0.29
255 0.28
256 0.29
257 0.29
258 0.3
259 0.29
260 0.31
261 0.31
262 0.28
263 0.25
264 0.2
265 0.19
266 0.17