Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SG94

Protein Details
Accession A0A397SG94    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
129-158EPEDEKTKEKTKEKQKEKTKEKQEEEQQEPAcidic
NLS Segment(s)
PositionSequence
140-144KEKQK
Subcellular Location(s) nucl 15.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MDEYAIYVYDLHFFSSNRSNTAGVKGATKIIAEQHSEGNKSEIKVRFIGELEIQQAQDDPNEIGQTVPTGGTELDNIPEQEPETNDDLINDIEKQEEAEGEEQQEKQPEEELEPEPEEQKQPEKEDELEPEDEKTKEKTKEKQKEKTKEKQEEEQQEPENSREGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.26
3 0.27
4 0.26
5 0.28
6 0.28
7 0.27
8 0.31
9 0.31
10 0.23
11 0.24
12 0.23
13 0.22
14 0.22
15 0.2
16 0.17
17 0.17
18 0.19
19 0.19
20 0.19
21 0.23
22 0.26
23 0.27
24 0.27
25 0.25
26 0.24
27 0.23
28 0.29
29 0.27
30 0.27
31 0.27
32 0.27
33 0.26
34 0.24
35 0.25
36 0.19
37 0.17
38 0.16
39 0.15
40 0.14
41 0.12
42 0.12
43 0.1
44 0.09
45 0.09
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.05
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.08
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.1
70 0.11
71 0.11
72 0.11
73 0.11
74 0.11
75 0.1
76 0.1
77 0.08
78 0.06
79 0.05
80 0.05
81 0.06
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.09
88 0.11
89 0.11
90 0.12
91 0.15
92 0.14
93 0.13
94 0.15
95 0.15
96 0.14
97 0.18
98 0.18
99 0.17
100 0.18
101 0.19
102 0.17
103 0.18
104 0.18
105 0.16
106 0.21
107 0.22
108 0.24
109 0.27
110 0.29
111 0.3
112 0.31
113 0.34
114 0.31
115 0.3
116 0.27
117 0.26
118 0.26
119 0.24
120 0.24
121 0.24
122 0.28
123 0.34
124 0.41
125 0.49
126 0.57
127 0.67
128 0.75
129 0.81
130 0.84
131 0.87
132 0.89
133 0.9
134 0.9
135 0.89
136 0.86
137 0.85
138 0.85
139 0.83
140 0.8
141 0.77
142 0.7
143 0.64
144 0.6
145 0.52
146 0.47