Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TMJ4

Protein Details
Accession A0A397TMJ4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
74-93RSVPRRMRIRLARRRNDEEDBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR020052  Ribosomal_L31e_CS  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
PROSITE View protein in PROSITE  
PS01144  RIBOSOMAL_L31E  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MAKEKKPTTRSAIADVVTRDYTIHLHKSIHGRSFKKRAPHAVKAIQDFAKKHMGTNDVRLDPLLNKEIWKQGVRSVPRRMRIRLARRRNDEEDAKEKLYTHVSYVPMISFKGTQTEIVDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.37
4 0.29
5 0.25
6 0.2
7 0.16
8 0.18
9 0.18
10 0.21
11 0.19
12 0.2
13 0.24
14 0.32
15 0.36
16 0.4
17 0.44
18 0.45
19 0.51
20 0.59
21 0.59
22 0.59
23 0.6
24 0.63
25 0.64
26 0.67
27 0.67
28 0.64
29 0.64
30 0.58
31 0.57
32 0.49
33 0.44
34 0.37
35 0.32
36 0.33
37 0.29
38 0.27
39 0.26
40 0.27
41 0.25
42 0.3
43 0.32
44 0.25
45 0.25
46 0.24
47 0.22
48 0.18
49 0.19
50 0.15
51 0.1
52 0.1
53 0.12
54 0.15
55 0.18
56 0.18
57 0.17
58 0.2
59 0.27
60 0.31
61 0.36
62 0.43
63 0.46
64 0.53
65 0.58
66 0.56
67 0.58
68 0.63
69 0.67
70 0.68
71 0.73
72 0.74
73 0.77
74 0.82
75 0.78
76 0.74
77 0.7
78 0.66
79 0.61
80 0.56
81 0.5
82 0.43
83 0.38
84 0.34
85 0.32
86 0.26
87 0.24
88 0.24
89 0.23
90 0.24
91 0.24
92 0.23
93 0.19
94 0.19
95 0.18
96 0.14
97 0.13
98 0.17
99 0.17
100 0.18