Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SX07

Protein Details
Accession A0A397SX07   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-123SDPAQRFRRNCKKIMKRKGVKREKKADLEEEBasic
NLS Segment(s)
PositionSequence
104-117KKIMKRKGVKREKK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
Amino Acid Sequences MAIKLYEQNDDNLQEFDKDELLLILLKYLLRDVLDPAAEEIQHAKKQWERIYDDDTYFTYSKPPENTPEWAYDAEKIRTKQRTSKCLNTEDESDPAQRFRRNCKKIMKRKGVKREKKADLEEETIDAIFNVEVVYSDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.14
5 0.12
6 0.11
7 0.09
8 0.09
9 0.09
10 0.08
11 0.07
12 0.07
13 0.08
14 0.08
15 0.08
16 0.08
17 0.07
18 0.08
19 0.09
20 0.11
21 0.11
22 0.11
23 0.12
24 0.12
25 0.11
26 0.11
27 0.13
28 0.15
29 0.16
30 0.17
31 0.19
32 0.21
33 0.28
34 0.32
35 0.35
36 0.35
37 0.36
38 0.4
39 0.4
40 0.37
41 0.32
42 0.28
43 0.26
44 0.22
45 0.18
46 0.16
47 0.15
48 0.17
49 0.18
50 0.2
51 0.2
52 0.22
53 0.26
54 0.25
55 0.26
56 0.25
57 0.23
58 0.22
59 0.2
60 0.21
61 0.2
62 0.23
63 0.22
64 0.27
65 0.32
66 0.34
67 0.4
68 0.44
69 0.51
70 0.54
71 0.61
72 0.6
73 0.6
74 0.61
75 0.55
76 0.52
77 0.45
78 0.4
79 0.33
80 0.3
81 0.25
82 0.24
83 0.25
84 0.25
85 0.26
86 0.34
87 0.44
88 0.47
89 0.54
90 0.62
91 0.69
92 0.76
93 0.84
94 0.85
95 0.84
96 0.89
97 0.92
98 0.92
99 0.92
100 0.91
101 0.91
102 0.88
103 0.87
104 0.82
105 0.78
106 0.72
107 0.65
108 0.56
109 0.47
110 0.39
111 0.3
112 0.24
113 0.17
114 0.12
115 0.08
116 0.07
117 0.05
118 0.04