Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S8Y9

Protein Details
Accession A0A397S8Y9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-63QLKIWESTKKDRKKPLRPLNYEKITKHydrophilic
NLS Segment(s)
PositionSequence
50-50K
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MLNGEIQRCNSKVKLRQLRQMIGTWQIDDKEVKAKNFQLKIWESTKKDRKKPLRPLNYEKITKQVNIAFKGWKIWLPRTMASHCQKPKLLSSLQGILEVVNITMIDNVDFKETTFGYGNIFDAVRGNSHATLRMLIQYQLPELPEIFEEQEQNHQKLFGQNRFSQQTFYIFNSVFEKLLAFDGDFTSSYCSDFEIMIYVIKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.72
4 0.74
5 0.75
6 0.69
7 0.64
8 0.56
9 0.52
10 0.47
11 0.39
12 0.33
13 0.28
14 0.27
15 0.24
16 0.22
17 0.23
18 0.25
19 0.26
20 0.29
21 0.35
22 0.41
23 0.43
24 0.43
25 0.43
26 0.43
27 0.47
28 0.48
29 0.5
30 0.46
31 0.53
32 0.62
33 0.63
34 0.68
35 0.73
36 0.77
37 0.8
38 0.86
39 0.87
40 0.88
41 0.87
42 0.88
43 0.88
44 0.85
45 0.79
46 0.68
47 0.63
48 0.55
49 0.46
50 0.41
51 0.35
52 0.33
53 0.32
54 0.33
55 0.28
56 0.26
57 0.28
58 0.25
59 0.24
60 0.22
61 0.22
62 0.25
63 0.27
64 0.29
65 0.31
66 0.33
67 0.38
68 0.38
69 0.43
70 0.41
71 0.42
72 0.42
73 0.39
74 0.39
75 0.35
76 0.32
77 0.27
78 0.27
79 0.27
80 0.25
81 0.23
82 0.2
83 0.15
84 0.15
85 0.11
86 0.08
87 0.04
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.11
106 0.09
107 0.09
108 0.07
109 0.08
110 0.08
111 0.07
112 0.08
113 0.09
114 0.1
115 0.1
116 0.12
117 0.11
118 0.12
119 0.12
120 0.13
121 0.12
122 0.12
123 0.13
124 0.11
125 0.12
126 0.12
127 0.12
128 0.11
129 0.1
130 0.1
131 0.09
132 0.1
133 0.1
134 0.1
135 0.11
136 0.11
137 0.2
138 0.24
139 0.25
140 0.24
141 0.23
142 0.23
143 0.3
144 0.37
145 0.34
146 0.37
147 0.39
148 0.46
149 0.51
150 0.5
151 0.45
152 0.39
153 0.37
154 0.33
155 0.32
156 0.3
157 0.25
158 0.26
159 0.27
160 0.26
161 0.22
162 0.18
163 0.16
164 0.12
165 0.14
166 0.13
167 0.1
168 0.1
169 0.1
170 0.12
171 0.12
172 0.12
173 0.14
174 0.13
175 0.14
176 0.13
177 0.13
178 0.13
179 0.12
180 0.12
181 0.11
182 0.11