Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TNZ4

Protein Details
Accession A0A397TNZ4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-75DSLLHKIKKKPKTLRAKAKKRREQGINRALVHydrophilic
81-102EIKIAKSLEKLNKKKRLKSIREHydrophilic
NLS Segment(s)
PositionSequence
50-102KIKKKPKTLRAKAKKRREQGINRALVIKEKVEIKIAKSLEKLNKKKRLKSIRE
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MGKPKRNRMQMQIDNEPTPPKSMNVDKWSLSSPGIKSINSRAEADSLLHKIKKKPKTLRAKAKKRREQGINRALVIKEKVEIKIAKSLEKLNKKKRLKSIRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.59
3 0.53
4 0.42
5 0.37
6 0.3
7 0.22
8 0.24
9 0.28
10 0.35
11 0.37
12 0.39
13 0.37
14 0.38
15 0.38
16 0.34
17 0.29
18 0.25
19 0.2
20 0.24
21 0.25
22 0.23
23 0.23
24 0.27
25 0.31
26 0.29
27 0.3
28 0.23
29 0.22
30 0.23
31 0.22
32 0.18
33 0.15
34 0.16
35 0.17
36 0.19
37 0.24
38 0.32
39 0.38
40 0.46
41 0.53
42 0.6
43 0.7
44 0.77
45 0.83
46 0.85
47 0.89
48 0.9
49 0.91
50 0.91
51 0.87
52 0.85
53 0.84
54 0.83
55 0.82
56 0.81
57 0.74
58 0.65
59 0.61
60 0.52
61 0.46
62 0.37
63 0.27
64 0.2
65 0.19
66 0.19
67 0.22
68 0.23
69 0.22
70 0.28
71 0.29
72 0.3
73 0.3
74 0.37
75 0.41
76 0.5
77 0.58
78 0.62
79 0.71
80 0.76
81 0.83
82 0.86