Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T3T3

Protein Details
Accession A0A397T3T3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-73PYGLYQYKHKNKKDYKRRNLKIREIIKKRBasic
NLS Segment(s)
PositionSequence
53-73HKNKKDYKRRNLKIREIIKKR
Subcellular Location(s) extr 8, E.R. 8, golg 5, mito 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MRKYDLFILIAVAIIFCLVTLSNGLPNDVDKSNLVKRSQDSPYRPYGLYQYKHKNKKDYKRRNLKIREIIKKRVPDDVPEPPLGEVSITEEDKAAFFKRKAPAETGHVDTASIFPGKTSNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.06
9 0.1
10 0.1
11 0.11
12 0.11
13 0.11
14 0.15
15 0.14
16 0.15
17 0.12
18 0.17
19 0.22
20 0.27
21 0.27
22 0.27
23 0.29
24 0.34
25 0.39
26 0.42
27 0.42
28 0.41
29 0.45
30 0.46
31 0.43
32 0.38
33 0.39
34 0.38
35 0.37
36 0.41
37 0.46
38 0.52
39 0.61
40 0.65
41 0.67
42 0.69
43 0.76
44 0.79
45 0.8
46 0.82
47 0.84
48 0.88
49 0.88
50 0.87
51 0.85
52 0.83
53 0.81
54 0.8
55 0.75
56 0.74
57 0.7
58 0.68
59 0.6
60 0.58
61 0.5
62 0.44
63 0.43
64 0.43
65 0.41
66 0.36
67 0.35
68 0.27
69 0.27
70 0.23
71 0.17
72 0.09
73 0.1
74 0.13
75 0.12
76 0.12
77 0.12
78 0.12
79 0.13
80 0.15
81 0.14
82 0.16
83 0.17
84 0.23
85 0.3
86 0.36
87 0.39
88 0.41
89 0.43
90 0.43
91 0.48
92 0.46
93 0.4
94 0.34
95 0.31
96 0.28
97 0.24
98 0.2
99 0.16
100 0.11
101 0.09