Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S2W2

Protein Details
Accession A0A397S2W2   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
104-128LEDIKRKIPTPRNKNNSKQNVLNIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000232  HSF_DNA-bd  
IPR027725  HSF_fam  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00447  HSF_DNA-bind  
PROSITE View protein in PROSITE  
PS00434  HSF_DOMAIN  
Amino Acid Sequences MACAAANIADFIKRLYRMLEDKSYAHIVSWGMTGDTFVVHDPTEFAKSILPQHFKHNNMASFVRQLNKYDFHKIKSNDDDARPYNEQAWEFQHPKFQLNRKDLLEDIKRKIPTPRNKNNSKQNVLNIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.21
4 0.25
5 0.31
6 0.35
7 0.33
8 0.33
9 0.36
10 0.37
11 0.31
12 0.27
13 0.23
14 0.17
15 0.15
16 0.15
17 0.11
18 0.08
19 0.08
20 0.08
21 0.06
22 0.06
23 0.06
24 0.05
25 0.06
26 0.06
27 0.06
28 0.07
29 0.08
30 0.1
31 0.1
32 0.1
33 0.1
34 0.12
35 0.18
36 0.23
37 0.26
38 0.25
39 0.33
40 0.39
41 0.4
42 0.44
43 0.43
44 0.38
45 0.37
46 0.37
47 0.29
48 0.26
49 0.26
50 0.23
51 0.19
52 0.2
53 0.19
54 0.23
55 0.24
56 0.3
57 0.31
58 0.31
59 0.38
60 0.38
61 0.42
62 0.42
63 0.45
64 0.4
65 0.4
66 0.42
67 0.37
68 0.4
69 0.36
70 0.32
71 0.29
72 0.27
73 0.25
74 0.22
75 0.25
76 0.25
77 0.26
78 0.26
79 0.3
80 0.28
81 0.33
82 0.38
83 0.42
84 0.44
85 0.47
86 0.52
87 0.48
88 0.5
89 0.46
90 0.48
91 0.49
92 0.46
93 0.46
94 0.47
95 0.47
96 0.46
97 0.54
98 0.56
99 0.57
100 0.62
101 0.68
102 0.71
103 0.79
104 0.87
105 0.89
106 0.89
107 0.86
108 0.82