Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SGG2

Protein Details
Accession A0A397SGG2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
150-171DYIPSSKPDQSQKKESNKQEEAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019192  Ribosomal_L28/L40_mit  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09812  MRP-L28  
Amino Acid Sequences MTFTYFPRSVLSTSIARKLLSRADASKKPRGPPSGTPGATNYNITDTRYEVIKRILYETPKPELPQFTEEDLERHETIERAWQLYLRNKREVKCREMEAKYRMLNEANIKLEQISKSLFVSAQLGNKTVLFPGQLKIPTETPPLNGWNYDYIPSSKPDQSQKKESNKQEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.31
5 0.32
6 0.33
7 0.31
8 0.32
9 0.32
10 0.38
11 0.46
12 0.51
13 0.57
14 0.57
15 0.59
16 0.63
17 0.63
18 0.61
19 0.6
20 0.62
21 0.62
22 0.57
23 0.52
24 0.47
25 0.46
26 0.41
27 0.35
28 0.27
29 0.21
30 0.22
31 0.21
32 0.2
33 0.16
34 0.16
35 0.18
36 0.18
37 0.16
38 0.19
39 0.2
40 0.2
41 0.22
42 0.24
43 0.26
44 0.3
45 0.32
46 0.32
47 0.31
48 0.32
49 0.3
50 0.29
51 0.28
52 0.26
53 0.24
54 0.22
55 0.22
56 0.21
57 0.19
58 0.18
59 0.19
60 0.15
61 0.14
62 0.13
63 0.11
64 0.11
65 0.16
66 0.16
67 0.13
68 0.13
69 0.14
70 0.17
71 0.25
72 0.33
73 0.31
74 0.38
75 0.41
76 0.43
77 0.51
78 0.53
79 0.5
80 0.46
81 0.47
82 0.47
83 0.48
84 0.51
85 0.45
86 0.45
87 0.41
88 0.38
89 0.35
90 0.28
91 0.27
92 0.25
93 0.25
94 0.22
95 0.2
96 0.19
97 0.18
98 0.2
99 0.17
100 0.15
101 0.12
102 0.11
103 0.11
104 0.12
105 0.11
106 0.09
107 0.12
108 0.13
109 0.16
110 0.16
111 0.16
112 0.16
113 0.17
114 0.16
115 0.13
116 0.12
117 0.1
118 0.1
119 0.11
120 0.15
121 0.17
122 0.19
123 0.21
124 0.22
125 0.24
126 0.27
127 0.27
128 0.25
129 0.26
130 0.27
131 0.26
132 0.25
133 0.24
134 0.23
135 0.24
136 0.23
137 0.22
138 0.22
139 0.22
140 0.24
141 0.27
142 0.27
143 0.32
144 0.41
145 0.49
146 0.53
147 0.62
148 0.69
149 0.75
150 0.81
151 0.84