Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SL31

Protein Details
Accession A0A397SL31   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
195-219KVEILPPSSKKEKNKEKNKDAEEEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 4.5, mito 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001229  Jacalin-like_lectin_dom  
IPR036404  Jacalin-like_lectin_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTIIVKSVSSKYGGNGGTYHNDFDDIINEYGGGSDIIENIYIKSIIIQSGDTVNSLQFTYDIKITDLVSVYTQSGEKLAEISGRYGNFTTTNITVIRYLEFRTSRRTVTCGQNNAEDIQFTLPVGVIYGSSGLYLDSIGSYEISYSPLVIILSCFISILGFCFFIAMVTFLANKLVIRFGIHFFGFPRFEENFEKVEILPPSSKKEKNKEKNKDAEEEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.28
5 0.28
6 0.28
7 0.21
8 0.22
9 0.2
10 0.19
11 0.18
12 0.16
13 0.15
14 0.14
15 0.13
16 0.12
17 0.12
18 0.12
19 0.09
20 0.05
21 0.05
22 0.05
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.07
29 0.07
30 0.08
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.11
37 0.11
38 0.1
39 0.1
40 0.09
41 0.09
42 0.09
43 0.08
44 0.07
45 0.08
46 0.09
47 0.1
48 0.11
49 0.11
50 0.12
51 0.12
52 0.13
53 0.12
54 0.11
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.1
69 0.12
70 0.12
71 0.13
72 0.12
73 0.13
74 0.11
75 0.12
76 0.13
77 0.1
78 0.12
79 0.11
80 0.12
81 0.12
82 0.11
83 0.12
84 0.1
85 0.1
86 0.13
87 0.15
88 0.16
89 0.22
90 0.23
91 0.24
92 0.24
93 0.27
94 0.27
95 0.33
96 0.38
97 0.36
98 0.35
99 0.35
100 0.34
101 0.32
102 0.27
103 0.19
104 0.13
105 0.1
106 0.08
107 0.06
108 0.06
109 0.05
110 0.04
111 0.05
112 0.04
113 0.03
114 0.03
115 0.04
116 0.04
117 0.03
118 0.04
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.05
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.06
154 0.05
155 0.06
156 0.06
157 0.06
158 0.07
159 0.07
160 0.07
161 0.07
162 0.08
163 0.08
164 0.1
165 0.12
166 0.13
167 0.17
168 0.17
169 0.17
170 0.17
171 0.22
172 0.21
173 0.2
174 0.23
175 0.2
176 0.24
177 0.28
178 0.3
179 0.27
180 0.27
181 0.28
182 0.23
183 0.27
184 0.25
185 0.24
186 0.26
187 0.27
188 0.33
189 0.4
190 0.47
191 0.5
192 0.6
193 0.68
194 0.73
195 0.82
196 0.86
197 0.87
198 0.91
199 0.87