Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TGL0

Protein Details
Accession A0A397TGL0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
92-120QLRNNVYSRQHHKKQRKELIKNNNFDRNRHydrophilic
NLS Segment(s)
PositionSequence
105-108KQRK
118-122RNRKK
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MNKFPSKLSISFSYKANHKKFCPFLLSYTSNYSTASKLKPQQQIQRIQSSVPAGTILKGLNFHKDGADPIALPDDDYPNWLWEILDKEKDEQLRNNVYSRQHHKKQRKELIKNNNFDRNRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.55
4 0.54
5 0.52
6 0.59
7 0.61
8 0.6
9 0.58
10 0.5
11 0.46
12 0.46
13 0.45
14 0.39
15 0.4
16 0.37
17 0.31
18 0.31
19 0.28
20 0.23
21 0.24
22 0.24
23 0.25
24 0.29
25 0.37
26 0.44
27 0.5
28 0.56
29 0.6
30 0.66
31 0.64
32 0.65
33 0.57
34 0.49
35 0.44
36 0.36
37 0.29
38 0.2
39 0.16
40 0.1
41 0.09
42 0.1
43 0.08
44 0.07
45 0.09
46 0.1
47 0.12
48 0.13
49 0.13
50 0.12
51 0.12
52 0.13
53 0.12
54 0.12
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.11
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.14
71 0.16
72 0.2
73 0.2
74 0.21
75 0.25
76 0.29
77 0.3
78 0.3
79 0.33
80 0.37
81 0.38
82 0.4
83 0.41
84 0.43
85 0.48
86 0.53
87 0.56
88 0.58
89 0.67
90 0.74
91 0.8
92 0.85
93 0.87
94 0.89
95 0.9
96 0.91
97 0.92
98 0.91
99 0.89
100 0.85
101 0.85
102 0.78