Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TG40

Protein Details
Accession A0A397TG40   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-39EEIVVSKEKKNKKKAELSEAFKSHydrophilic
NLS Segment(s)
PositionSequence
25-30KKNKKK
Subcellular Location(s) cyto 15.5, cyto_nucl 14.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MIPEESSESSSPEKMIEEIVVSKEKKNKKKAELSEAFKSKYAANLLDQLVPKLIPFILKNLLIQDLKKCCSINNIWKVEALREIRKRLIVDCTFTCAKVTVKALIDSKSFYDSISKVLAKKIDLYISREYGSKYPAVRDLSIGVTNAGKKVMRRGWIDKEEVSVTLLNIFDEKVSCIRKIDIANFVVIDKPEYGLVLGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.13
4 0.12
5 0.14
6 0.16
7 0.22
8 0.22
9 0.26
10 0.33
11 0.43
12 0.5
13 0.58
14 0.65
15 0.68
16 0.77
17 0.81
18 0.84
19 0.83
20 0.8
21 0.8
22 0.76
23 0.67
24 0.58
25 0.51
26 0.4
27 0.35
28 0.32
29 0.24
30 0.2
31 0.23
32 0.24
33 0.27
34 0.26
35 0.23
36 0.21
37 0.19
38 0.16
39 0.12
40 0.11
41 0.1
42 0.1
43 0.12
44 0.15
45 0.16
46 0.17
47 0.17
48 0.2
49 0.19
50 0.19
51 0.22
52 0.23
53 0.24
54 0.26
55 0.25
56 0.21
57 0.26
58 0.32
59 0.35
60 0.4
61 0.41
62 0.39
63 0.41
64 0.41
65 0.36
66 0.35
67 0.29
68 0.28
69 0.29
70 0.32
71 0.31
72 0.34
73 0.33
74 0.29
75 0.33
76 0.27
77 0.26
78 0.24
79 0.27
80 0.25
81 0.24
82 0.23
83 0.16
84 0.15
85 0.14
86 0.15
87 0.13
88 0.13
89 0.16
90 0.17
91 0.17
92 0.17
93 0.15
94 0.15
95 0.14
96 0.13
97 0.11
98 0.12
99 0.11
100 0.12
101 0.15
102 0.15
103 0.14
104 0.16
105 0.18
106 0.16
107 0.18
108 0.17
109 0.19
110 0.2
111 0.23
112 0.24
113 0.24
114 0.25
115 0.23
116 0.24
117 0.2
118 0.2
119 0.19
120 0.17
121 0.17
122 0.22
123 0.24
124 0.22
125 0.22
126 0.22
127 0.21
128 0.21
129 0.19
130 0.14
131 0.13
132 0.14
133 0.13
134 0.13
135 0.12
136 0.12
137 0.2
138 0.24
139 0.29
140 0.34
141 0.4
142 0.47
143 0.51
144 0.54
145 0.46
146 0.45
147 0.4
148 0.34
149 0.29
150 0.21
151 0.16
152 0.14
153 0.14
154 0.11
155 0.1
156 0.1
157 0.08
158 0.09
159 0.1
160 0.14
161 0.17
162 0.18
163 0.2
164 0.21
165 0.26
166 0.3
167 0.32
168 0.33
169 0.31
170 0.32
171 0.3
172 0.29
173 0.27
174 0.22
175 0.2
176 0.14
177 0.14
178 0.12
179 0.12
180 0.12