Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T6Z5

Protein Details
Accession A0A397T6Z5   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-47IAKIASMKQKTNKKKKRKKEALESDNDFHydrophilic
NLS Segment(s)
PositionSequence
22-38KIASMKQKTNKKKKRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MKNDERHEKLFKAKKEIVVIAKIASMKQKTNKKKKRKKEALESDNDFDDSLLNDNISKKKANSIPKVSGLISHQKAIGKLVTEFREQWHCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.59
4 0.53
5 0.47
6 0.42
7 0.33
8 0.3
9 0.26
10 0.22
11 0.22
12 0.2
13 0.22
14 0.3
15 0.39
16 0.48
17 0.59
18 0.69
19 0.74
20 0.82
21 0.88
22 0.92
23 0.93
24 0.91
25 0.91
26 0.92
27 0.88
28 0.86
29 0.78
30 0.68
31 0.58
32 0.48
33 0.37
34 0.25
35 0.17
36 0.1
37 0.08
38 0.07
39 0.06
40 0.07
41 0.1
42 0.12
43 0.14
44 0.16
45 0.14
46 0.22
47 0.28
48 0.37
49 0.43
50 0.48
51 0.5
52 0.52
53 0.54
54 0.47
55 0.43
56 0.37
57 0.38
58 0.32
59 0.29
60 0.28
61 0.27
62 0.28
63 0.28
64 0.26
65 0.19
66 0.2
67 0.25
68 0.26
69 0.28
70 0.28
71 0.3