Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SRC6

Protein Details
Accession A0A397SRC6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-66DKINKISRRKESKEEKKEKERKPYELBasic
NLS Segment(s)
PositionSequence
42-62KINKISRRKESKEEKKEKERK
Subcellular Location(s) plas 7, E.R. 5, mito 4, extr 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MKLSLISITLIVLIALSTVLALPTPVVKEIDNIKIKRDQSDKINKISRRKESKEEKKEKERKPYELSPEEVAKWERIIGAGKRDIVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.05
11 0.06
12 0.07
13 0.08
14 0.08
15 0.11
16 0.14
17 0.22
18 0.28
19 0.28
20 0.3
21 0.34
22 0.35
23 0.38
24 0.38
25 0.33
26 0.35
27 0.45
28 0.46
29 0.48
30 0.54
31 0.53
32 0.58
33 0.62
34 0.63
35 0.61
36 0.63
37 0.65
38 0.69
39 0.76
40 0.79
41 0.81
42 0.8
43 0.82
44 0.88
45 0.86
46 0.86
47 0.81
48 0.77
49 0.75
50 0.73
51 0.71
52 0.66
53 0.62
54 0.55
55 0.51
56 0.44
57 0.4
58 0.35
59 0.27
60 0.23
61 0.2
62 0.16
63 0.16
64 0.21
65 0.21
66 0.26
67 0.29