Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SSY9

Protein Details
Accession A0A397SSY9   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MVRKSRSDKKDTTCKRCGKVCVNPNKLREHLRRKNLCKPKTNTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MVRKSRSDKKDTTCKRCGKVCVNPNKLREHLRRKNLCKPKTNTPIQAPVQEVNQEAIQASESSSVNMSNKEKPHVVIPTPIPELEPEKEALVLESELRHGEEDCKNVGKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.76
5 0.74
6 0.73
7 0.74
8 0.75
9 0.76
10 0.77
11 0.74
12 0.72
13 0.67
14 0.66
15 0.67
16 0.67
17 0.66
18 0.7
19 0.76
20 0.77
21 0.83
22 0.84
23 0.82
24 0.8
25 0.77
26 0.77
27 0.76
28 0.75
29 0.7
30 0.64
31 0.65
32 0.57
33 0.54
34 0.45
35 0.36
36 0.31
37 0.26
38 0.22
39 0.15
40 0.13
41 0.1
42 0.08
43 0.07
44 0.07
45 0.05
46 0.05
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.12
54 0.15
55 0.17
56 0.19
57 0.22
58 0.23
59 0.23
60 0.27
61 0.27
62 0.26
63 0.26
64 0.27
65 0.28
66 0.29
67 0.28
68 0.24
69 0.21
70 0.24
71 0.2
72 0.2
73 0.16
74 0.15
75 0.16
76 0.15
77 0.14
78 0.12
79 0.1
80 0.1
81 0.09
82 0.1
83 0.11
84 0.11
85 0.12
86 0.11
87 0.17
88 0.2
89 0.22
90 0.25