Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TBA8

Protein Details
Accession A0A397TBA8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-44QKINLGNNNRRTRKKPPKLCLDCKKTTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSSTNYEQNTRNTPYVQKINLGNNNRRTRKKPPKLCLDCKKTTDCIKLLSNKVNKLEEVVNNFKNPPKKKPDKFSTFNAKFTLNDVPCELEYDLANFSLENLHKLVIFTTQNCTSKNDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.45
4 0.43
5 0.43
6 0.49
7 0.54
8 0.57
9 0.58
10 0.6
11 0.69
12 0.72
13 0.74
14 0.71
15 0.74
16 0.78
17 0.8
18 0.81
19 0.8
20 0.83
21 0.86
22 0.9
23 0.89
24 0.86
25 0.82
26 0.76
27 0.7
28 0.64
29 0.6
30 0.55
31 0.46
32 0.41
33 0.39
34 0.41
35 0.41
36 0.44
37 0.42
38 0.4
39 0.42
40 0.39
41 0.34
42 0.3
43 0.29
44 0.24
45 0.25
46 0.26
47 0.24
48 0.24
49 0.25
50 0.26
51 0.31
52 0.32
53 0.34
54 0.39
55 0.49
56 0.55
57 0.64
58 0.71
59 0.72
60 0.73
61 0.74
62 0.75
63 0.67
64 0.63
65 0.55
66 0.46
67 0.38
68 0.36
69 0.37
70 0.26
71 0.24
72 0.22
73 0.23
74 0.21
75 0.24
76 0.21
77 0.13
78 0.13
79 0.13
80 0.13
81 0.11
82 0.11
83 0.08
84 0.08
85 0.12
86 0.12
87 0.13
88 0.13
89 0.13
90 0.14
91 0.14
92 0.15
93 0.15
94 0.18
95 0.17
96 0.23
97 0.3
98 0.33
99 0.34
100 0.39