Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SIG0

Protein Details
Accession A0A397SIG0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MIQSKNGQKQRQRFRHYPRNLHMNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIQSKNGQKQRQRFRHYPRNLHMNVLIFPEFIVDVPNFRVICIWVGIHLVSLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.86
5 0.81
6 0.8
7 0.72
8 0.64
9 0.57
10 0.47
11 0.39
12 0.31
13 0.25
14 0.15
15 0.14
16 0.11
17 0.09
18 0.07
19 0.08
20 0.05
21 0.06
22 0.08
23 0.13
24 0.13
25 0.12
26 0.13
27 0.12
28 0.14
29 0.14
30 0.13
31 0.09
32 0.11
33 0.11