Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T3P7

Protein Details
Accession A0A397T3P7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
157-182YYYDYDHKKDDHKKKKEEKGILLNNFHydrophilic
NLS Segment(s)
PositionSequence
170-171KK
Subcellular Location(s) cyto 12, cyto_nucl 12, nucl 10, vacu 3
Family & Domain DBs
Amino Acid Sequences MVEWWTELFSKVNTDMLISFLREIKLLDEDDLQLLEKEKVAGLDFLFFSGDNFHVCGLKWGPALRLANAAWYIKHKKAEYLPPNTCAVLNRLSQSLGLPSVSFKFIFIYISKFKTVTKIDIAPIAESNSNSNVELNNKHDATPSQYYYDDDKKKEYYYYDYDHKKDDHKKKKEEKGILLNNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.17
5 0.15
6 0.15
7 0.15
8 0.16
9 0.15
10 0.15
11 0.14
12 0.16
13 0.16
14 0.16
15 0.15
16 0.15
17 0.15
18 0.15
19 0.14
20 0.11
21 0.12
22 0.11
23 0.1
24 0.1
25 0.09
26 0.1
27 0.1
28 0.11
29 0.09
30 0.11
31 0.11
32 0.1
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.12
44 0.11
45 0.13
46 0.14
47 0.14
48 0.15
49 0.2
50 0.21
51 0.18
52 0.2
53 0.17
54 0.17
55 0.18
56 0.18
57 0.12
58 0.17
59 0.21
60 0.22
61 0.26
62 0.25
63 0.27
64 0.32
65 0.41
66 0.43
67 0.47
68 0.46
69 0.44
70 0.45
71 0.41
72 0.37
73 0.27
74 0.22
75 0.16
76 0.15
77 0.14
78 0.13
79 0.13
80 0.13
81 0.12
82 0.11
83 0.08
84 0.07
85 0.06
86 0.06
87 0.07
88 0.08
89 0.08
90 0.07
91 0.08
92 0.08
93 0.09
94 0.09
95 0.13
96 0.15
97 0.17
98 0.18
99 0.18
100 0.18
101 0.23
102 0.24
103 0.22
104 0.23
105 0.23
106 0.23
107 0.25
108 0.26
109 0.2
110 0.19
111 0.17
112 0.15
113 0.13
114 0.14
115 0.13
116 0.13
117 0.13
118 0.13
119 0.12
120 0.15
121 0.18
122 0.2
123 0.24
124 0.23
125 0.23
126 0.25
127 0.25
128 0.28
129 0.31
130 0.29
131 0.26
132 0.26
133 0.28
134 0.33
135 0.41
136 0.41
137 0.37
138 0.4
139 0.4
140 0.41
141 0.42
142 0.39
143 0.37
144 0.36
145 0.4
146 0.45
147 0.5
148 0.5
149 0.52
150 0.51
151 0.54
152 0.59
153 0.64
154 0.65
155 0.68
156 0.76
157 0.82
158 0.9
159 0.91
160 0.89
161 0.88
162 0.88