Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SXA5

Protein Details
Accession A0A397SXA5    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
72-95NCKGNCNSKKCNCKKMGNNCGSQCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_nucl 10.5, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR046341  SET_dom_sf  
Amino Acid Sequences MINQMNKGKKRLNYYEIEDLVRISVLKIDHFEIDPLGVKHYPELETISTNTITVREVTRLQNIGLTTGIICNCKGNCNSKKCNCKKMGNNCGSQCHGSRHCQNKHEDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.58
4 0.54
5 0.45
6 0.37
7 0.3
8 0.24
9 0.18
10 0.09
11 0.1
12 0.09
13 0.09
14 0.11
15 0.12
16 0.13
17 0.13
18 0.13
19 0.11
20 0.11
21 0.13
22 0.11
23 0.13
24 0.12
25 0.11
26 0.12
27 0.13
28 0.13
29 0.12
30 0.14
31 0.12
32 0.12
33 0.13
34 0.14
35 0.12
36 0.11
37 0.11
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.11
44 0.12
45 0.15
46 0.15
47 0.15
48 0.16
49 0.15
50 0.14
51 0.12
52 0.1
53 0.08
54 0.09
55 0.1
56 0.08
57 0.08
58 0.11
59 0.11
60 0.15
61 0.18
62 0.26
63 0.33
64 0.41
65 0.5
66 0.56
67 0.67
68 0.71
69 0.79
70 0.77
71 0.79
72 0.8
73 0.82
74 0.84
75 0.8
76 0.8
77 0.73
78 0.71
79 0.65
80 0.58
81 0.5
82 0.48
83 0.46
84 0.45
85 0.51
86 0.56
87 0.6
88 0.64