Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S5P7

Protein Details
Accession A0A397S5P7    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-39AYFCTCKKCKDSSQDNQRFLKTKKTYKHQKAELLRNISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.833, cyto 6, cyto_pero 3.999
Family & Domain DBs
Amino Acid Sequences MAYFCTCKKCKDSSQDNQXRFLKTKKTYKXHQKAELLRNISGDLNTTDTNLTNSDDDVTIMETDSEEDKKSDLSDKQVLVPKLFQIKNFSRISVKEHQVNKLDNVPNLSEKNDEMDTLNDKDNDEFDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.82
4 0.79
5 0.75
6 0.72
7 0.64
8 0.63
9 0.61
10 0.6
11 0.62
12 0.68
13 0.74
14 0.77
15 0.85
16 0.82
17 0.82
18 0.82
19 0.83
20 0.81
21 0.76
22 0.66
23 0.56
24 0.5
25 0.41
26 0.32
27 0.23
28 0.16
29 0.12
30 0.12
31 0.12
32 0.11
33 0.1
34 0.11
35 0.11
36 0.11
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.07
44 0.06
45 0.06
46 0.06
47 0.04
48 0.05
49 0.06
50 0.07
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.11
57 0.11
58 0.15
59 0.19
60 0.19
61 0.24
62 0.29
63 0.29
64 0.26
65 0.26
66 0.23
67 0.28
68 0.28
69 0.26
70 0.28
71 0.31
72 0.37
73 0.37
74 0.37
75 0.31
76 0.32
77 0.37
78 0.38
79 0.39
80 0.39
81 0.42
82 0.46
83 0.48
84 0.49
85 0.45
86 0.45
87 0.44
88 0.38
89 0.37
90 0.34
91 0.34
92 0.33
93 0.32
94 0.25
95 0.22
96 0.25
97 0.22
98 0.21
99 0.17
100 0.19
101 0.22
102 0.23
103 0.26
104 0.23
105 0.24
106 0.24
107 0.23