Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TKT6

Protein Details
Accession A0A397TKT6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-102PNYVYRPNRNKFKVEKKRQQRSQTTSKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 12.666, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MYDASQPIKRIPRPPNAFILYRREKQPGIIASQKNLTNAEVSRLIADMWRKEPEEIRLEWERYAEQRKLEHMQAPNYVYRPNRNKFKVEKKRQQRSQTTSKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.63
4 0.61
5 0.56
6 0.58
7 0.54
8 0.52
9 0.51
10 0.47
11 0.43
12 0.41
13 0.44
14 0.37
15 0.35
16 0.39
17 0.36
18 0.34
19 0.38
20 0.37
21 0.31
22 0.29
23 0.24
24 0.18
25 0.17
26 0.18
27 0.15
28 0.14
29 0.13
30 0.12
31 0.11
32 0.11
33 0.13
34 0.11
35 0.13
36 0.14
37 0.15
38 0.15
39 0.17
40 0.19
41 0.21
42 0.2
43 0.22
44 0.24
45 0.25
46 0.24
47 0.24
48 0.21
49 0.21
50 0.26
51 0.23
52 0.22
53 0.23
54 0.27
55 0.3
56 0.31
57 0.33
58 0.32
59 0.33
60 0.34
61 0.35
62 0.33
63 0.31
64 0.33
65 0.3
66 0.35
67 0.41
68 0.46
69 0.54
70 0.56
71 0.63
72 0.68
73 0.77
74 0.78
75 0.81
76 0.83
77 0.84
78 0.91
79 0.92
80 0.93
81 0.92
82 0.9