Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SE02

Protein Details
Accession A0A397SE02    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
8-27QEQRQKAQETRKRNNLCQNCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MERKGFTQEQRQKAQETRKRNNLCQNCSQYGHFTNKCTNEKVRLNHRIPNTEEFDPVKAVMNAPIGITVAQYIKEKPNAAKKIRNSLRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.66
3 0.67
4 0.68
5 0.71
6 0.75
7 0.77
8 0.8
9 0.78
10 0.76
11 0.75
12 0.73
13 0.66
14 0.62
15 0.55
16 0.49
17 0.44
18 0.46
19 0.39
20 0.34
21 0.36
22 0.4
23 0.42
24 0.41
25 0.39
26 0.38
27 0.43
28 0.46
29 0.49
30 0.52
31 0.51
32 0.53
33 0.53
34 0.5
35 0.47
36 0.47
37 0.42
38 0.33
39 0.33
40 0.29
41 0.27
42 0.23
43 0.2
44 0.17
45 0.13
46 0.12
47 0.12
48 0.12
49 0.11
50 0.11
51 0.1
52 0.09
53 0.08
54 0.08
55 0.07
56 0.07
57 0.08
58 0.1
59 0.12
60 0.17
61 0.21
62 0.24
63 0.3
64 0.4
65 0.47
66 0.53
67 0.59
68 0.61
69 0.69