Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TGK8

Protein Details
Accession A0A397TGK8   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KAKRSSRKKVGPYNKFMKSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito_nucl 14, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010422  Ccdc124/Oxs1  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF06244  Ccdc124  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences KAKRSSRKKVGPYNKFMKSELPKVKEELPGLSHKEAFAMVAKRWKDSPENPKNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.65
4 0.63
5 0.57
6 0.58
7 0.57
8 0.52
9 0.46
10 0.46
11 0.48
12 0.43
13 0.38
14 0.29
15 0.24
16 0.24
17 0.26
18 0.25
19 0.22
20 0.18
21 0.18
22 0.16
23 0.14
24 0.15
25 0.14
26 0.15
27 0.22
28 0.23
29 0.25
30 0.27
31 0.3
32 0.33
33 0.4
34 0.49