Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SMI3

Protein Details
Accession A0A397SMI3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
31-58YRTCNSCHVKPSQRKKNTKKRSYEDTNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSTTAVCTSCSQLKSLSDFTGFRIKDTIKQYRTCNSCHVKPSQRKKNTKKRSYEDTNSLEIVKEDTDSLEVVKITNFFDFIMQLLSIYTTQLKNEKNMPSFHFECKVDISTLNNSAKKVADYLVELIEKADEFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.29
4 0.27
5 0.26
6 0.28
7 0.34
8 0.31
9 0.27
10 0.28
11 0.27
12 0.31
13 0.39
14 0.45
15 0.41
16 0.47
17 0.5
18 0.54
19 0.56
20 0.51
21 0.52
22 0.5
23 0.5
24 0.49
25 0.54
26 0.56
27 0.63
28 0.71
29 0.73
30 0.76
31 0.81
32 0.87
33 0.9
34 0.91
35 0.91
36 0.89
37 0.85
38 0.84
39 0.83
40 0.78
41 0.75
42 0.67
43 0.6
44 0.51
45 0.44
46 0.34
47 0.25
48 0.2
49 0.12
50 0.08
51 0.06
52 0.05
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.05
74 0.06
75 0.08
76 0.08
77 0.09
78 0.15
79 0.16
80 0.19
81 0.25
82 0.31
83 0.32
84 0.35
85 0.37
86 0.39
87 0.4
88 0.41
89 0.4
90 0.35
91 0.33
92 0.33
93 0.31
94 0.25
95 0.23
96 0.23
97 0.22
98 0.28
99 0.32
100 0.31
101 0.3
102 0.31
103 0.31
104 0.29
105 0.26
106 0.2
107 0.16
108 0.17
109 0.18
110 0.2
111 0.19
112 0.18
113 0.16
114 0.16