Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T5G7

Protein Details
Accession A0A397T5G7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
98-136LQKSKVFKIKQYKHNPERVPRKRGPNKKKVPESIRLNKNHydrophilic
NLS Segment(s)
PositionSequence
105-127KIKQYKHNPERVPRKRGPNKKKV
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MTPFFSSMVAPIKYEINGVHYMKIYGIIYELPSPDSKMYKKYLKCNNFCAFRVSCIEALKTITSDCIEVSRYAAACWSIASQEFKDFFTKYSQTIKELQKSKVFKIKQYKHNPERVPRKRGPNKKKVPESIRLNKNELSVEQEIGMCKNYQEELEHFASIEPVPYSPSPYSYYMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.16
4 0.22
5 0.22
6 0.23
7 0.22
8 0.22
9 0.21
10 0.23
11 0.18
12 0.12
13 0.12
14 0.1
15 0.11
16 0.12
17 0.13
18 0.12
19 0.13
20 0.14
21 0.16
22 0.2
23 0.2
24 0.24
25 0.3
26 0.37
27 0.42
28 0.49
29 0.58
30 0.63
31 0.66
32 0.69
33 0.7
34 0.67
35 0.62
36 0.59
37 0.49
38 0.41
39 0.4
40 0.34
41 0.29
42 0.24
43 0.24
44 0.19
45 0.19
46 0.17
47 0.13
48 0.11
49 0.1
50 0.09
51 0.09
52 0.08
53 0.08
54 0.09
55 0.08
56 0.09
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.07
63 0.07
64 0.07
65 0.06
66 0.07
67 0.09
68 0.09
69 0.12
70 0.12
71 0.13
72 0.15
73 0.15
74 0.14
75 0.16
76 0.17
77 0.16
78 0.22
79 0.22
80 0.23
81 0.3
82 0.33
83 0.36
84 0.4
85 0.41
86 0.42
87 0.43
88 0.45
89 0.46
90 0.43
91 0.43
92 0.49
93 0.55
94 0.58
95 0.67
96 0.74
97 0.73
98 0.81
99 0.79
100 0.78
101 0.81
102 0.79
103 0.77
104 0.73
105 0.77
106 0.78
107 0.83
108 0.84
109 0.84
110 0.86
111 0.87
112 0.89
113 0.88
114 0.84
115 0.82
116 0.82
117 0.81
118 0.79
119 0.73
120 0.68
121 0.6
122 0.56
123 0.48
124 0.39
125 0.35
126 0.27
127 0.24
128 0.21
129 0.2
130 0.18
131 0.17
132 0.18
133 0.12
134 0.1
135 0.12
136 0.12
137 0.12
138 0.14
139 0.15
140 0.2
141 0.23
142 0.22
143 0.21
144 0.2
145 0.2
146 0.17
147 0.17
148 0.12
149 0.1
150 0.14
151 0.14
152 0.19
153 0.19
154 0.22
155 0.24