Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SX72

Protein Details
Accession A0A397SX72   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MNKPLKPTTPKRRNSLKKQWDKTTKVVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001715  CH_dom  
IPR036872  CH_dom_sf  
Gene Ontology GO:0016043  P:cellular component organization  
Pfam View protein in Pfam  
PF00307  CH  
PROSITE View protein in PROSITE  
PS50021  CH  
Amino Acid Sequences MNKPLKPTTPKRRNSLKKQWDKTTKVVNVKQKFYSTEANKYTALQIATFTKWVNIQFQIKAIDKDFRDGKKLIELLELFYENDVEELPKPERGKTRVHYIQNVNKVIEFLQKKLDDNGLAALKAIGPVDIVDGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.88
4 0.89
5 0.9
6 0.91
7 0.9
8 0.85
9 0.81
10 0.8
11 0.76
12 0.75
13 0.73
14 0.73
15 0.69
16 0.68
17 0.65
18 0.57
19 0.52
20 0.47
21 0.49
22 0.43
23 0.45
24 0.43
25 0.42
26 0.4
27 0.38
28 0.35
29 0.28
30 0.24
31 0.16
32 0.15
33 0.14
34 0.14
35 0.14
36 0.13
37 0.11
38 0.13
39 0.13
40 0.15
41 0.15
42 0.17
43 0.17
44 0.19
45 0.22
46 0.21
47 0.22
48 0.2
49 0.22
50 0.19
51 0.23
52 0.26
53 0.23
54 0.25
55 0.24
56 0.23
57 0.23
58 0.23
59 0.2
60 0.18
61 0.17
62 0.15
63 0.15
64 0.15
65 0.11
66 0.1
67 0.1
68 0.07
69 0.07
70 0.06
71 0.05
72 0.05
73 0.09
74 0.1
75 0.14
76 0.15
77 0.19
78 0.26
79 0.28
80 0.35
81 0.36
82 0.45
83 0.49
84 0.53
85 0.56
86 0.58
87 0.63
88 0.64
89 0.63
90 0.53
91 0.45
92 0.41
93 0.34
94 0.34
95 0.28
96 0.22
97 0.27
98 0.28
99 0.29
100 0.31
101 0.34
102 0.26
103 0.25
104 0.29
105 0.22
106 0.2
107 0.19
108 0.17
109 0.13
110 0.13
111 0.13
112 0.07
113 0.06
114 0.06