Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SYW1

Protein Details
Accession A0A397SYW1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPKSFRVKHYKRPQPSNRKATGFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.499, mito 13, nucl 11.5, cyto_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKSFRVKHYKRPQPSNRKATGFLLFRQEFGKKNKYKTQHKLSTAASRAWTRLPEKEKNSYLNRYEKSNHSFLRRTATTSKPQLEHMDVIDTNPNDSGND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.92
3 0.91
4 0.88
5 0.81
6 0.74
7 0.67
8 0.64
9 0.55
10 0.47
11 0.46
12 0.38
13 0.35
14 0.35
15 0.33
16 0.31
17 0.34
18 0.42
19 0.38
20 0.44
21 0.51
22 0.58
23 0.65
24 0.7
25 0.74
26 0.73
27 0.71
28 0.69
29 0.65
30 0.64
31 0.55
32 0.47
33 0.39
34 0.31
35 0.29
36 0.25
37 0.25
38 0.19
39 0.23
40 0.27
41 0.32
42 0.35
43 0.41
44 0.43
45 0.47
46 0.5
47 0.5
48 0.49
49 0.51
50 0.48
51 0.45
52 0.45
53 0.45
54 0.46
55 0.47
56 0.45
57 0.43
58 0.45
59 0.43
60 0.48
61 0.42
62 0.42
63 0.41
64 0.43
65 0.45
66 0.49
67 0.53
68 0.46
69 0.49
70 0.49
71 0.46
72 0.42
73 0.35
74 0.33
75 0.27
76 0.27
77 0.3
78 0.25
79 0.23
80 0.21