Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S7J9

Protein Details
Accession A0A397S7J9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21IRHFLSRKNIKKKRINLDSLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, E.R. 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences IRHFLSRKNIKKKRINLDSLSFNLYLLSFLLFVFVFLQTRCFIYNTRFFSRSQNWNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.77
4 0.74
5 0.68
6 0.6
7 0.54
8 0.42
9 0.33
10 0.25
11 0.19
12 0.14
13 0.09
14 0.08
15 0.04
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.08
25 0.08
26 0.09
27 0.1
28 0.11
29 0.13
30 0.18
31 0.27
32 0.32
33 0.38
34 0.38
35 0.38
36 0.46
37 0.52