Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TBZ6

Protein Details
Accession A0A397TBZ6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
139-165KGNPSIPTIKPRPKPWEKKNMNNDNDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MTEQIFKAFENYDFENDTNFQTGLPSILNSHQDKPKEKLDALIEKAKCFYYSKVIQEFDYDNYLTWKTNTNKLASSNIKDNVESSSVITSSKSDVNNNPQTEQTADNPQYPRTFYQLVEMIAEEQPIPGIKQIPNELNKGNPSIPTIKPRPKPWEKKNMNNDNDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.25
5 0.22
6 0.19
7 0.16
8 0.14
9 0.14
10 0.12
11 0.11
12 0.1
13 0.1
14 0.13
15 0.2
16 0.22
17 0.27
18 0.31
19 0.37
20 0.41
21 0.44
22 0.47
23 0.46
24 0.43
25 0.43
26 0.44
27 0.45
28 0.45
29 0.48
30 0.43
31 0.38
32 0.39
33 0.34
34 0.29
35 0.24
36 0.21
37 0.21
38 0.25
39 0.3
40 0.34
41 0.34
42 0.33
43 0.34
44 0.33
45 0.27
46 0.25
47 0.19
48 0.14
49 0.15
50 0.16
51 0.13
52 0.12
53 0.19
54 0.18
55 0.25
56 0.27
57 0.27
58 0.28
59 0.29
60 0.36
61 0.31
62 0.31
63 0.29
64 0.3
65 0.29
66 0.27
67 0.25
68 0.2
69 0.18
70 0.15
71 0.11
72 0.09
73 0.08
74 0.09
75 0.08
76 0.07
77 0.08
78 0.11
79 0.12
80 0.14
81 0.17
82 0.25
83 0.32
84 0.33
85 0.32
86 0.29
87 0.29
88 0.28
89 0.27
90 0.21
91 0.22
92 0.23
93 0.26
94 0.27
95 0.28
96 0.28
97 0.28
98 0.27
99 0.24
100 0.25
101 0.2
102 0.23
103 0.24
104 0.23
105 0.21
106 0.2
107 0.17
108 0.15
109 0.15
110 0.11
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.11
117 0.12
118 0.17
119 0.21
120 0.28
121 0.3
122 0.34
123 0.34
124 0.34
125 0.35
126 0.34
127 0.31
128 0.25
129 0.26
130 0.28
131 0.31
132 0.36
133 0.43
134 0.49
135 0.55
136 0.63
137 0.69
138 0.75
139 0.82
140 0.83
141 0.85
142 0.85
143 0.88
144 0.91
145 0.91