Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SV00

Protein Details
Accession A0A397SV00    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-40GSGLLKKIRKPKFQSLPKKLKEVRHydrophilic
NLS Segment(s)
PositionSequence
22-29KKIRKPKF
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MELVFSIGIRWNLSSEGSGLLKKIRKPKFQSLPKKLKEVRTSTLIYNLGILQVFKIFGFLDAISNDDSLDVTVSWMISFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.13
4 0.13
5 0.13
6 0.13
7 0.17
8 0.21
9 0.25
10 0.34
11 0.4
12 0.48
13 0.55
14 0.65
15 0.7
16 0.76
17 0.83
18 0.83
19 0.86
20 0.79
21 0.81
22 0.74
23 0.72
24 0.68
25 0.62
26 0.55
27 0.49
28 0.48
29 0.39
30 0.39
31 0.31
32 0.24
33 0.2
34 0.16
35 0.12
36 0.1
37 0.1
38 0.06
39 0.06
40 0.06
41 0.05
42 0.06
43 0.05
44 0.06
45 0.07
46 0.07
47 0.09
48 0.08
49 0.1
50 0.1
51 0.1
52 0.1
53 0.08
54 0.08
55 0.07
56 0.08
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07