Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S7V2

Protein Details
Accession A0A397S7V2   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
75-104KKDIKRKNTGSKKDTKRKKTNGNKFAKKTIBasic
NLS Segment(s)
PositionSequence
72-101ANGKKDIKRKNTGSKKDTKRKKTNGNKFAK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.833, cyto 6
Family & Domain DBs
Amino Acid Sequences MKIQKEANDFLQQKIEVLETQLSLFNNPKINSFGSILMLTCSVKTNNIKSEEGEGDEDGKIKIYDDKNTKEANGKKDIKRKNTGSKKDTKRKKTNGNKFAKKTISDNDTIEAVSNKTKEKILVQSSSSFTDSSSSESESSFENIGEKGMEEEEKEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.17
4 0.18
5 0.18
6 0.13
7 0.14
8 0.16
9 0.15
10 0.16
11 0.18
12 0.19
13 0.24
14 0.24
15 0.25
16 0.25
17 0.26
18 0.27
19 0.26
20 0.23
21 0.18
22 0.18
23 0.16
24 0.14
25 0.14
26 0.11
27 0.1
28 0.11
29 0.09
30 0.14
31 0.18
32 0.22
33 0.27
34 0.31
35 0.31
36 0.3
37 0.34
38 0.3
39 0.28
40 0.25
41 0.19
42 0.16
43 0.15
44 0.15
45 0.11
46 0.1
47 0.08
48 0.08
49 0.13
50 0.14
51 0.2
52 0.25
53 0.29
54 0.32
55 0.33
56 0.33
57 0.35
58 0.38
59 0.36
60 0.4
61 0.44
62 0.46
63 0.54
64 0.6
65 0.59
66 0.62
67 0.63
68 0.65
69 0.68
70 0.71
71 0.69
72 0.72
73 0.76
74 0.78
75 0.81
76 0.81
77 0.81
78 0.81
79 0.86
80 0.87
81 0.87
82 0.88
83 0.89
84 0.87
85 0.81
86 0.8
87 0.72
88 0.63
89 0.56
90 0.52
91 0.45
92 0.39
93 0.36
94 0.3
95 0.26
96 0.24
97 0.21
98 0.16
99 0.13
100 0.13
101 0.14
102 0.14
103 0.15
104 0.16
105 0.17
106 0.2
107 0.27
108 0.3
109 0.32
110 0.32
111 0.35
112 0.36
113 0.37
114 0.34
115 0.26
116 0.21
117 0.19
118 0.17
119 0.17
120 0.17
121 0.16
122 0.16
123 0.16
124 0.17
125 0.16
126 0.18
127 0.15
128 0.13
129 0.12
130 0.12
131 0.12
132 0.12
133 0.1
134 0.1
135 0.11
136 0.12
137 0.12