Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L4M2

Protein Details
Accession E2L4M2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-84APSSPPKKAAQVPKRKKRVEKELTPHydrophilic
92-111APNRQTKRPKHSHKGEPGSPBasic
NLS Segment(s)
PositionSequence
65-105PKKAAQVPKRKKRVEKELTPVPLAKAVAPNRQTKRPKHSHK
Subcellular Location(s) mito 7extr 7, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003822  PAH  
IPR036600  PAH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG mpr:MPER_00657  -  
Pfam View protein in Pfam  
PF02671  PAH  
PROSITE View protein in PROSITE  
PS51477  PAH  
Amino Acid Sequences MFVKSQVFAQVSAVFMDAPDLFAEFKDFLPEAVPGFHGGILQHSLAGSGSMPWLQGDISAPSSPPKKAAQVPKRKKRVEKELTPVPLAKAVAPNRQTKRPKHSHKGEPGSPTFSPYPVAAQIPSEHTGLPPSSSSLSVSHAPGTLSSLANGISTNPTDKLLFFDRAGESLENREIYEEFLKLLSLYPKEIIDVKTLLDRTGAFFDGDLLDEFRDLVGVGSKAATAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.12
4 0.09
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.11
11 0.1
12 0.1
13 0.13
14 0.13
15 0.13
16 0.14
17 0.15
18 0.13
19 0.13
20 0.13
21 0.11
22 0.11
23 0.11
24 0.1
25 0.1
26 0.11
27 0.11
28 0.11
29 0.1
30 0.09
31 0.09
32 0.08
33 0.08
34 0.06
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.07
44 0.08
45 0.11
46 0.11
47 0.11
48 0.15
49 0.18
50 0.17
51 0.19
52 0.2
53 0.22
54 0.29
55 0.4
56 0.46
57 0.55
58 0.66
59 0.73
60 0.81
61 0.83
62 0.85
63 0.83
64 0.84
65 0.82
66 0.79
67 0.76
68 0.74
69 0.7
70 0.63
71 0.54
72 0.43
73 0.36
74 0.28
75 0.21
76 0.2
77 0.2
78 0.24
79 0.28
80 0.35
81 0.37
82 0.46
83 0.52
84 0.52
85 0.6
86 0.64
87 0.7
88 0.71
89 0.77
90 0.77
91 0.79
92 0.8
93 0.74
94 0.69
95 0.61
96 0.55
97 0.46
98 0.4
99 0.3
100 0.23
101 0.2
102 0.15
103 0.15
104 0.11
105 0.12
106 0.08
107 0.09
108 0.09
109 0.11
110 0.13
111 0.12
112 0.11
113 0.1
114 0.12
115 0.11
116 0.11
117 0.09
118 0.08
119 0.09
120 0.09
121 0.1
122 0.1
123 0.12
124 0.13
125 0.14
126 0.13
127 0.13
128 0.12
129 0.11
130 0.12
131 0.11
132 0.1
133 0.09
134 0.09
135 0.09
136 0.09
137 0.09
138 0.07
139 0.07
140 0.08
141 0.09
142 0.09
143 0.11
144 0.11
145 0.11
146 0.15
147 0.17
148 0.19
149 0.17
150 0.2
151 0.19
152 0.2
153 0.22
154 0.18
155 0.15
156 0.16
157 0.18
158 0.16
159 0.15
160 0.16
161 0.14
162 0.16
163 0.17
164 0.14
165 0.12
166 0.11
167 0.12
168 0.1
169 0.12
170 0.14
171 0.14
172 0.15
173 0.16
174 0.16
175 0.18
176 0.21
177 0.2
178 0.19
179 0.18
180 0.18
181 0.22
182 0.22
183 0.21
184 0.19
185 0.18
186 0.17
187 0.2
188 0.2
189 0.14
190 0.14
191 0.15
192 0.14
193 0.15
194 0.13
195 0.11
196 0.1
197 0.1
198 0.1
199 0.08
200 0.08
201 0.07
202 0.06
203 0.09
204 0.09
205 0.09
206 0.1