Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SSP2

Protein Details
Accession A0A397SSP2    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-43KSTNTQGESSKKKKKKVKSTPAADKQGSVHydrophilic
243-267PAEMFLTKKKNKKKAGDRPRYQGPPHydrophilic
322-342DFIAMRVKRVHKKVRALTRYGHydrophilic
NLS Segment(s)
PositionSequence
24-32SKKKKKKVK
250-262KKKNKKKAGDRPR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSSLNVYLAKRYGAKSTNTQGESSKKKKKKVKSTPAADKQGSVAIIDEEDITGQWKNIRSEDEEDEEAPIVDFSTETQQSSKWKPIVDDIGDEAPQIVNASNELLEYISSEVSEEPKPKRHKSSPPIKTSSGLDVGLQSADKVRKDLKRVKKDEKDLVNKMDPSLSGRGAATIYRDNVGTKIDKAAKRAEERRKIEEEEKLLKWGKEEENRREEELLNKPLAIYKDDKDLNEELKAKERWNDPAEMFLTKKKNKKKAGDRPRYQGPPAPPNRFNIQPGFRWDGIDRSNGYERQYFEKRNTRAALASEAYKWSVEDMLLKWHDFIAMRVKRVHKKVRALTRYGYLKIMLLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.47
4 0.53
5 0.51
6 0.51
7 0.49
8 0.52
9 0.58
10 0.6
11 0.63
12 0.62
13 0.7
14 0.78
15 0.83
16 0.86
17 0.87
18 0.89
19 0.88
20 0.92
21 0.93
22 0.93
23 0.92
24 0.81
25 0.7
26 0.6
27 0.53
28 0.42
29 0.31
30 0.21
31 0.13
32 0.12
33 0.12
34 0.1
35 0.07
36 0.07
37 0.07
38 0.08
39 0.07
40 0.08
41 0.12
42 0.16
43 0.19
44 0.22
45 0.25
46 0.28
47 0.32
48 0.36
49 0.37
50 0.34
51 0.31
52 0.3
53 0.27
54 0.22
55 0.17
56 0.13
57 0.08
58 0.06
59 0.06
60 0.06
61 0.12
62 0.12
63 0.13
64 0.14
65 0.16
66 0.22
67 0.27
68 0.33
69 0.3
70 0.31
71 0.31
72 0.36
73 0.4
74 0.36
75 0.33
76 0.29
77 0.28
78 0.26
79 0.24
80 0.19
81 0.12
82 0.11
83 0.1
84 0.07
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.05
96 0.05
97 0.06
98 0.06
99 0.09
100 0.12
101 0.16
102 0.18
103 0.27
104 0.35
105 0.4
106 0.49
107 0.55
108 0.62
109 0.68
110 0.75
111 0.76
112 0.78
113 0.77
114 0.69
115 0.63
116 0.54
117 0.48
118 0.39
119 0.29
120 0.21
121 0.16
122 0.15
123 0.13
124 0.11
125 0.07
126 0.09
127 0.11
128 0.11
129 0.13
130 0.18
131 0.22
132 0.3
133 0.4
134 0.47
135 0.55
136 0.63
137 0.71
138 0.73
139 0.76
140 0.77
141 0.76
142 0.73
143 0.67
144 0.64
145 0.57
146 0.49
147 0.42
148 0.35
149 0.26
150 0.21
151 0.19
152 0.14
153 0.11
154 0.11
155 0.11
156 0.11
157 0.11
158 0.1
159 0.09
160 0.09
161 0.09
162 0.1
163 0.09
164 0.1
165 0.11
166 0.1
167 0.09
168 0.13
169 0.19
170 0.2
171 0.22
172 0.27
173 0.3
174 0.35
175 0.44
176 0.49
177 0.52
178 0.55
179 0.58
180 0.57
181 0.56
182 0.53
183 0.49
184 0.44
185 0.4
186 0.37
187 0.36
188 0.34
189 0.31
190 0.28
191 0.28
192 0.29
193 0.31
194 0.39
195 0.42
196 0.46
197 0.48
198 0.48
199 0.45
200 0.4
201 0.39
202 0.38
203 0.33
204 0.27
205 0.25
206 0.24
207 0.25
208 0.25
209 0.21
210 0.18
211 0.15
212 0.22
213 0.24
214 0.25
215 0.26
216 0.27
217 0.26
218 0.27
219 0.29
220 0.23
221 0.28
222 0.3
223 0.27
224 0.31
225 0.32
226 0.35
227 0.34
228 0.37
229 0.3
230 0.32
231 0.33
232 0.29
233 0.28
234 0.27
235 0.33
236 0.36
237 0.44
238 0.49
239 0.58
240 0.65
241 0.74
242 0.79
243 0.81
244 0.86
245 0.89
246 0.87
247 0.85
248 0.85
249 0.79
250 0.71
251 0.66
252 0.61
253 0.61
254 0.62
255 0.63
256 0.56
257 0.55
258 0.57
259 0.54
260 0.51
261 0.48
262 0.44
263 0.4
264 0.44
265 0.46
266 0.41
267 0.41
268 0.38
269 0.35
270 0.33
271 0.33
272 0.28
273 0.27
274 0.32
275 0.32
276 0.34
277 0.33
278 0.33
279 0.37
280 0.43
281 0.42
282 0.45
283 0.53
284 0.53
285 0.57
286 0.57
287 0.52
288 0.47
289 0.45
290 0.42
291 0.35
292 0.34
293 0.27
294 0.26
295 0.24
296 0.21
297 0.19
298 0.15
299 0.14
300 0.12
301 0.14
302 0.13
303 0.21
304 0.23
305 0.23
306 0.23
307 0.22
308 0.24
309 0.2
310 0.22
311 0.24
312 0.27
313 0.3
314 0.37
315 0.45
316 0.52
317 0.62
318 0.69
319 0.68
320 0.73
321 0.8
322 0.84
323 0.83
324 0.79
325 0.74
326 0.73
327 0.7
328 0.62
329 0.54
330 0.44
331 0.37