Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T2E0

Protein Details
Accession A0A397T2E0    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-82KNVKRIPSPEERKKKTEKGYBasic
NLS Segment(s)
PositionSequence
74-76RKK
Subcellular Location(s) mito 16, cyto_nucl 9, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01658  Ribosomal_L30  
Amino Acid Sequences NSTKIQNGFFKITLQRSTIGLPLKLRRVVRALGLRRLQQTVYHSQTAYIAGMILKVKEILQVKNVKRIPSPEERKKKTEKGYVII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.28
4 0.29
5 0.29
6 0.26
7 0.24
8 0.25
9 0.28
10 0.32
11 0.36
12 0.35
13 0.33
14 0.33
15 0.31
16 0.33
17 0.37
18 0.36
19 0.38
20 0.41
21 0.41
22 0.4
23 0.4
24 0.34
25 0.28
26 0.28
27 0.28
28 0.28
29 0.26
30 0.24
31 0.23
32 0.23
33 0.21
34 0.17
35 0.1
36 0.06
37 0.05
38 0.06
39 0.07
40 0.06
41 0.05
42 0.06
43 0.06
44 0.11
45 0.13
46 0.13
47 0.2
48 0.29
49 0.3
50 0.4
51 0.43
52 0.41
53 0.41
54 0.44
55 0.44
56 0.46
57 0.55
58 0.57
59 0.65
60 0.69
61 0.74
62 0.78
63 0.81
64 0.8
65 0.79