Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2R810

Protein Details
Accession A2R810    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
177-203QKFHVRKGMVRKQLRMKRWRNLFKYSFHydrophilic
NLS Segment(s)
PositionSequence
182-194RKGMVRKQLRMKR
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ang:ANI_1_758144  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MDMRALSRSLLRSRPTTSILYKNQLPAARIGLRFSSESSSPSNKNNNTTQSPARQTQQPSSTSTPTQKPTDFDQILNKLNFNNTTTTTTPTPAAASGTTTTRAFNDSLSLSRAVGLSAETDSLRTATSLRKIDLKLGPTLGRQVTVEPERGMDLPAALRSLGTVISQNKMRQSLAKQKFHVRKGMVRKQLRMKRWRNLFKYSFGATVKRIQKIRGQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.45
4 0.45
5 0.48
6 0.5
7 0.51
8 0.5
9 0.49
10 0.51
11 0.48
12 0.43
13 0.36
14 0.36
15 0.36
16 0.33
17 0.32
18 0.28
19 0.27
20 0.27
21 0.26
22 0.23
23 0.18
24 0.2
25 0.23
26 0.27
27 0.27
28 0.33
29 0.4
30 0.4
31 0.44
32 0.48
33 0.5
34 0.48
35 0.51
36 0.51
37 0.49
38 0.51
39 0.5
40 0.47
41 0.46
42 0.46
43 0.48
44 0.48
45 0.42
46 0.42
47 0.43
48 0.43
49 0.41
50 0.42
51 0.4
52 0.39
53 0.42
54 0.38
55 0.36
56 0.38
57 0.43
58 0.39
59 0.36
60 0.37
61 0.38
62 0.41
63 0.39
64 0.34
65 0.25
66 0.25
67 0.25
68 0.2
69 0.18
70 0.15
71 0.19
72 0.19
73 0.22
74 0.21
75 0.21
76 0.2
77 0.18
78 0.16
79 0.12
80 0.12
81 0.08
82 0.09
83 0.08
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.11
90 0.1
91 0.09
92 0.1
93 0.09
94 0.1
95 0.11
96 0.11
97 0.09
98 0.09
99 0.09
100 0.07
101 0.07
102 0.06
103 0.05
104 0.05
105 0.06
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.05
112 0.06
113 0.08
114 0.14
115 0.16
116 0.17
117 0.21
118 0.22
119 0.27
120 0.29
121 0.28
122 0.24
123 0.24
124 0.25
125 0.21
126 0.24
127 0.19
128 0.16
129 0.14
130 0.14
131 0.17
132 0.18
133 0.19
134 0.16
135 0.16
136 0.16
137 0.17
138 0.16
139 0.11
140 0.09
141 0.09
142 0.09
143 0.09
144 0.07
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.1
151 0.11
152 0.15
153 0.19
154 0.21
155 0.24
156 0.26
157 0.26
158 0.27
159 0.33
160 0.41
161 0.47
162 0.52
163 0.53
164 0.61
165 0.69
166 0.68
167 0.69
168 0.63
169 0.62
170 0.65
171 0.71
172 0.71
173 0.69
174 0.72
175 0.75
176 0.79
177 0.8
178 0.8
179 0.79
180 0.79
181 0.84
182 0.86
183 0.81
184 0.83
185 0.77
186 0.72
187 0.69
188 0.62
189 0.57
190 0.49
191 0.46
192 0.39
193 0.44
194 0.45
195 0.46
196 0.46
197 0.44
198 0.49