Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SNF1

Protein Details
Accession A0A397SNF1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRFYFVRKKTYHKLKRNRNELRNECNKLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MRFYFVRKKTYHKLKRNRNELRNECNKLKDMLEEEKVNNKDRYQQKINELEKKVSDLKAPLSAIYKLAKISETIDHDYGAGETLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.9
3 0.92
4 0.92
5 0.9
6 0.9
7 0.87
8 0.86
9 0.85
10 0.81
11 0.73
12 0.66
13 0.59
14 0.5
15 0.43
16 0.36
17 0.3
18 0.28
19 0.28
20 0.26
21 0.26
22 0.31
23 0.33
24 0.34
25 0.31
26 0.27
27 0.32
28 0.36
29 0.42
30 0.4
31 0.42
32 0.44
33 0.52
34 0.57
35 0.57
36 0.53
37 0.48
38 0.43
39 0.43
40 0.39
41 0.31
42 0.27
43 0.2
44 0.2
45 0.22
46 0.22
47 0.19
48 0.19
49 0.19
50 0.19
51 0.19
52 0.18
53 0.15
54 0.15
55 0.15
56 0.13
57 0.15
58 0.18
59 0.22
60 0.26
61 0.26
62 0.25
63 0.25
64 0.24
65 0.22