Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TRL8

Protein Details
Accession A0A397TRL8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
135-163VACVRSCKECLHKRAKRKIFKLLHLNSRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
CDD cd09917  F-box_SF  
Amino Acid Sequences MDSMEVEDLGVLSPKEFNQLYAILKFFSEPIRYPPDAKMQDNISYEIFINICYHLPPKDLLMLACVCKHFKNMLDGSILPISWDIWKTSRERFTPFKDMDPPKGLNEMEFSRLLNFESGCEFCKRNDKRIHIYWVACVRSCKECLHKRAKRKIFKLLHLNSRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.14
4 0.15
5 0.16
6 0.19
7 0.22
8 0.23
9 0.23
10 0.18
11 0.18
12 0.18
13 0.16
14 0.17
15 0.17
16 0.16
17 0.21
18 0.28
19 0.3
20 0.31
21 0.33
22 0.39
23 0.41
24 0.41
25 0.39
26 0.35
27 0.39
28 0.38
29 0.37
30 0.28
31 0.23
32 0.22
33 0.19
34 0.16
35 0.11
36 0.1
37 0.09
38 0.09
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.11
45 0.13
46 0.13
47 0.12
48 0.13
49 0.13
50 0.13
51 0.14
52 0.14
53 0.13
54 0.13
55 0.15
56 0.14
57 0.14
58 0.19
59 0.19
60 0.19
61 0.2
62 0.19
63 0.2
64 0.18
65 0.16
66 0.1
67 0.09
68 0.08
69 0.07
70 0.08
71 0.06
72 0.08
73 0.1
74 0.13
75 0.18
76 0.24
77 0.25
78 0.29
79 0.34
80 0.39
81 0.45
82 0.44
83 0.41
84 0.45
85 0.46
86 0.46
87 0.45
88 0.4
89 0.33
90 0.36
91 0.32
92 0.24
93 0.24
94 0.21
95 0.19
96 0.18
97 0.17
98 0.14
99 0.14
100 0.14
101 0.13
102 0.11
103 0.09
104 0.11
105 0.12
106 0.13
107 0.16
108 0.16
109 0.17
110 0.27
111 0.3
112 0.37
113 0.45
114 0.51
115 0.56
116 0.62
117 0.68
118 0.64
119 0.61
120 0.59
121 0.57
122 0.52
123 0.46
124 0.41
125 0.37
126 0.35
127 0.37
128 0.35
129 0.38
130 0.45
131 0.52
132 0.61
133 0.67
134 0.73
135 0.81
136 0.86
137 0.87
138 0.85
139 0.86
140 0.83
141 0.84
142 0.85
143 0.82