Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TGA4

Protein Details
Accession A0A397TGA4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-31ILWAVPKKKTSHSKKRMRSANKGLKDKTHydrophilic
NLS Segment(s)
PositionSequence
10-26KKKTSHSKKRMRSANKG
Subcellular Location(s) mito_nucl 13.833, mito 13.5, nucl 13, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LGPILWAVPKKKTSHSKKRMRSANKGLKDKTNIIDCPGCGQKHLIHHLCFNCYKDFNYREK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.73
3 0.77
4 0.81
5 0.88
6 0.89
7 0.86
8 0.86
9 0.85
10 0.85
11 0.82
12 0.8
13 0.72
14 0.68
15 0.63
16 0.56
17 0.48
18 0.43
19 0.35
20 0.3
21 0.29
22 0.24
23 0.24
24 0.26
25 0.22
26 0.18
27 0.2
28 0.21
29 0.25
30 0.34
31 0.36
32 0.33
33 0.39
34 0.41
35 0.44
36 0.44
37 0.41
38 0.37
39 0.33
40 0.35
41 0.37