Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397RZS9

Protein Details
Accession A0A397RZS9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
74-93PTPAAIRKPSPKKDAKKDVGHydrophilic
NLS Segment(s)
PositionSequence
107-117KRELLKKSKNK
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MSPTTPTKTKSKSPNGYIFFYKFYKKILEEEYSNLSPQNRMKKSGEFWRSLPNDLKNSFIEYANDYRILNSIQPTPAAIRKPSPKKDAKKDVGLVVIFDDLSYNSKKRELLKKSKNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.72
3 0.71
4 0.67
5 0.59
6 0.53
7 0.46
8 0.42
9 0.33
10 0.31
11 0.32
12 0.28
13 0.31
14 0.31
15 0.33
16 0.31
17 0.33
18 0.37
19 0.32
20 0.31
21 0.28
22 0.23
23 0.23
24 0.26
25 0.33
26 0.29
27 0.33
28 0.36
29 0.38
30 0.43
31 0.49
32 0.49
33 0.41
34 0.41
35 0.45
36 0.44
37 0.43
38 0.42
39 0.36
40 0.36
41 0.34
42 0.35
43 0.26
44 0.27
45 0.25
46 0.21
47 0.18
48 0.15
49 0.17
50 0.15
51 0.16
52 0.13
53 0.12
54 0.12
55 0.12
56 0.11
57 0.11
58 0.12
59 0.11
60 0.11
61 0.12
62 0.13
63 0.16
64 0.17
65 0.17
66 0.21
67 0.3
68 0.4
69 0.46
70 0.53
71 0.59
72 0.66
73 0.75
74 0.8
75 0.77
76 0.75
77 0.72
78 0.66
79 0.61
80 0.51
81 0.41
82 0.31
83 0.25
84 0.17
85 0.13
86 0.11
87 0.07
88 0.1
89 0.13
90 0.14
91 0.16
92 0.19
93 0.23
94 0.31
95 0.41
96 0.49
97 0.56
98 0.66