Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SJ44

Protein Details
Accession A0A397SJ44   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-34DLQEKFSKDVFRKKRNKNVIRNLSNSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MTTINNEDLQEKFSKDVFRKKRNKNVIRNLSNSDEMCQYGVDCRKKLCGLKHPQYFNHHLMLKYKKEIELEKHKRDFKKESRIFMHKYRNRELIKNILKVKSNKNGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.42
4 0.49
5 0.57
6 0.66
7 0.74
8 0.82
9 0.86
10 0.9
11 0.9
12 0.91
13 0.91
14 0.87
15 0.81
16 0.75
17 0.68
18 0.61
19 0.51
20 0.41
21 0.31
22 0.25
23 0.21
24 0.16
25 0.12
26 0.13
27 0.2
28 0.22
29 0.22
30 0.22
31 0.25
32 0.28
33 0.33
34 0.33
35 0.36
36 0.42
37 0.5
38 0.56
39 0.57
40 0.57
41 0.58
42 0.59
43 0.51
44 0.46
45 0.39
46 0.33
47 0.35
48 0.38
49 0.35
50 0.32
51 0.32
52 0.29
53 0.29
54 0.32
55 0.34
56 0.4
57 0.46
58 0.52
59 0.58
60 0.63
61 0.64
62 0.67
63 0.69
64 0.67
65 0.69
66 0.66
67 0.67
68 0.68
69 0.71
70 0.7
71 0.69
72 0.71
73 0.65
74 0.66
75 0.65
76 0.66
77 0.63
78 0.63
79 0.6
80 0.6
81 0.63
82 0.63
83 0.63
84 0.59
85 0.62
86 0.62
87 0.66