Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T184

Protein Details
Accession A0A397T184    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-63EYARRKDAKSVRIKKKKKNGTSKVKFKLRCBasic
NLS Segment(s)
PositionSequence
37-58RRKDAKSVRIKKKKKNGTSKVK
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPYIDFNKFISVSFIVESFFTMPKQIRDIKYFLEYARRKDAKSVRIKKKKKNGTSKVKFKLRCSRYLYTFVIEDAEKAEKLQKSLPPGLTVTDVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.12
4 0.13
5 0.11
6 0.11
7 0.1
8 0.13
9 0.14
10 0.15
11 0.2
12 0.26
13 0.28
14 0.31
15 0.33
16 0.32
17 0.33
18 0.33
19 0.29
20 0.32
21 0.31
22 0.32
23 0.4
24 0.39
25 0.36
26 0.43
27 0.48
28 0.47
29 0.56
30 0.62
31 0.63
32 0.72
33 0.8
34 0.81
35 0.84
36 0.85
37 0.84
38 0.85
39 0.84
40 0.85
41 0.87
42 0.88
43 0.87
44 0.85
45 0.8
46 0.76
47 0.76
48 0.69
49 0.68
50 0.65
51 0.62
52 0.58
53 0.6
54 0.54
55 0.46
56 0.42
57 0.33
58 0.28
59 0.22
60 0.17
61 0.13
62 0.14
63 0.12
64 0.12
65 0.18
66 0.17
67 0.2
68 0.25
69 0.26
70 0.31
71 0.38
72 0.39
73 0.36
74 0.36
75 0.36