Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397THW1

Protein Details
Accession A0A397THW1   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-127DDSIAGKKRKAAPNRKPTSKKKAKRTAANHydrophilic
NLS Segment(s)
PositionSequence
104-125GKKRKAAPNRKPTSKKKAKRTA
Subcellular Location(s) nucl 14.5, cyto_nucl 14, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046341  SET_dom_sf  
CDD cd08161  SET  
Amino Acid Sequences MNEDPFGNMVFLEGSEVNQVICWTKRDIKKGEELFVYYGGDVDREHWGHAENSEQVACVGDSEEEEIEFSDEIATGDEDEDEEGTINKYENNNVENINDDSIAGKKRKAAPNRKPTSKKKAKRTAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.1
4 0.09
5 0.09
6 0.1
7 0.11
8 0.12
9 0.14
10 0.18
11 0.26
12 0.32
13 0.4
14 0.44
15 0.45
16 0.53
17 0.54
18 0.52
19 0.46
20 0.42
21 0.35
22 0.31
23 0.27
24 0.17
25 0.14
26 0.1
27 0.09
28 0.07
29 0.08
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.12
36 0.13
37 0.13
38 0.1
39 0.11
40 0.1
41 0.1
42 0.08
43 0.08
44 0.08
45 0.06
46 0.05
47 0.04
48 0.04
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.06
74 0.08
75 0.09
76 0.12
77 0.15
78 0.16
79 0.16
80 0.17
81 0.17
82 0.18
83 0.18
84 0.17
85 0.14
86 0.13
87 0.12
88 0.15
89 0.2
90 0.18
91 0.18
92 0.23
93 0.33
94 0.41
95 0.51
96 0.59
97 0.64
98 0.74
99 0.83
100 0.88
101 0.89
102 0.9
103 0.91
104 0.91
105 0.9
106 0.9
107 0.91